Basic Vector Information
- Vector Name:
- pSZPT1
- Antibiotic Resistance:
- Ampicillin
- Length:
- 10231 bp
- Type:
- Yeast expression vector
- Replication origin:
- ori
- Source/Author:
- Kanda K, Ishida T, Hirota R, Ono S, Motomura K, Ikeda T, Kitamura K, Kuroda A.
- Promoter:
- nmt1
pSZPT1 vector Map
pSZPT1 vector Sequence
LOCUS 40924_42009 10231 bp DNA circular SYN 18-DEC-2018
DEFINITION Yeast expression vector pSZPT1 DNA, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 10231)
AUTHORS Kanda K, Ishida T, Hirota R, Ono S, Motomura K, Ikeda T, Kitamura K,
Kuroda A.
TITLE Application of a phosphite dehydrogenase gene as a novel dominant
selection marker for yeasts
JOURNAL J. Biotechnol. 182-183, 68-73 (2014)
PUBMED 24786825
REFERENCE 2 (bases 1 to 10231)
AUTHORS Hirota R.
TITLE Direct Submission
JOURNAL Submitted (06-NOV-2013) Contact:Ryuichi Hirota Hiroshima University,
Department of Biotechnology; 1-3-1, Higashi-Hiroshima, Hiroshima
739-8530, Japan
REFERENCE 3 (bases 1 to 10231)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 10231)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "J.
Biotechnol. 182-183, 68-73 (2014)"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(06-NOV-2013) Contact:Ryuichi Hirota Hiroshima University,
Department of Biotechnology; 1-3-1, Higashi-Hiroshima, Hiroshima
739-8530, Japan"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..10231
/mol_type="other DNA"
/organism="synthetic DNA construct"
source 1251..2261
/strain="4506"
/mol_type="other DNA"
/country="Japan"
/isolation_source="soil"
/collected_by="Hirota,R."
/collection_date=2011
/db_xref="taxon:1094341"
/organism="Ralstonia sp. 4506"
misc_feature 7..12
/label=SphI recognition site
/note="SphI recognition site"
misc_feature 13..18
/label=PstI recognition site
/note="PstI recognition site"
promoter 49..1204
/label=nmt1 promoter
/note="wild-type nmt1 promoter from Schizosaccharomyces
pombe, conferring strong thiamine-repressible expression"
misc_feature 1211..1216
/label=SalI recognition site
/note="SalI recognition site"
CDS 1233..1250
/label=6xHis
/note="6xHis affinity tag"
CDS 1251..2261
/codon_start=1
/gene="RsptxD"
/product="phosphite dehydrogenase"
/label=RsptxD
/protein_id="BAP74302.1"
/translation="MKPKVVLTHWVHPEIIELLSASADVIPNTTRETLPRSEVIARAKD
ADALMAFMPDSIDSAFLEECPKLRVIGAALKGYDNFDVNACTRHGVWLTIVPDLLTIPT
AELTIGLLLGLTRHMLEGDRQIRSGHFQGWRPTLYGSGLTGKTLGIIGMGAVGRAIAQR
LAGFEMNLLYCDPIPLNAEQEKAWHVQRVTLDELLEKCDYVVPMVPMAAETLHLIDATA
LAKMKTGSYLINACRGSVVDENAVIAALASGKLAGYAADVFEMEEWIRADRPQAIPKAL
LDNTAQTFFTPHLGSAVKEVRLEIERQAAMNIIQALAGEKPMGAINQPYPGVKAA"
gene 1251..2261
/gene="RsptxD"
/label=RsptxD
CDS 2262..2285
/label=FLAG
/note="FLAG(R) epitope tag, followed by an enterokinase
cleavage site"
CDS 2292..2315
/label=FLAG
/note="FLAG(R) epitope tag, followed by an enterokinase
cleavage site"
terminator 2367..2554
/label=ADH1 terminator
/note="transcription terminator for the S. cerevisiae
alcohol dehydrogenase 1 (ADH1) gene"
misc_feature 2584..2589
/label=SpeI recognition site
/note="SpeI recognition site"
misc_feature 2590..3816
/label=leu1-5'
/note="leu1-5'"
CDS complement(4221..5012)
/label=S. pombe ura4
/note="orotidine 5'-phosphate decarboxylase, required for
uracil biosynthesis"
misc_feature 5548..5553
/label=EcoRI recognition site
/note="EcoRI recognition site"
rep_origin complement(5621..6404)
/direction=LEFT
/label=ars1
/note="Schizosaccharomyces pombe autonomously replicating
sequence ars1"
misc_feature 6761..7114
/label=leu1-3'
/note="leu1-3'"
misc_feature 7115..7120
/label=SacI recognition site
/note="SacI recognition site"
misc_feature 7121..7126
/label=EcoRI recognition site
/note="EcoRI recognition site"
primer_bind complement(7127..7143)
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
rep_origin 7356..7811
/label=f1 ori
/note="f1 bacteriophage origin of replication; arrow
indicates direction of (+) strand synthesis"
promoter 8093..8197
/label=AmpR promoter
CDS 8198..9055
/label=AmpR
/note="beta-lactamase"
rep_origin 9229..9817
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
protein_bind 10105..10126
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
promoter 10141..10171
/label=lac promoter
/note="promoter for the E. coli lac operon"
protein_bind 10179..10195
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
primer_bind 10203..10219
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
This page is informational only.