Basic Vector Information
- Vector Name:
- pSyTMT
- Antibiotic Resistance:
- Ampicillin
- Length:
- 8289 bp
- Type:
- Chloroplast transformation vector
- Replication origin:
- ori
- Source/Author:
- Lu Y, Rijzaani H, Karcher D, Ruf S, Bock R.
pSyTMT vector Map
pSyTMT vector Sequence
LOCUS V002911 8289 bp DNA circular SYN 18-DEC-2018 DEFINITION Exported. ACCESSION V002911 VERSION V002911 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 8289) AUTHORS Lu Y, Rijzaani H, Karcher D, Ruf S, Bock R. TITLE Efficient engineering of the vitamin E metabolic pathway in transgenic tobacco and tomato plastids with synthetic multigene operons JOURNAL Unpublished REFERENCE 2 (bases 1 to 8289) AUTHORS Lu Y, Rijzaani H, Karcher D, Ruf S, Bock R. TITLE Direct Submission JOURNAL Submitted (25-JUN-2012) Organelle Biology, Biotechnology and Molecular Ecophysiology, Max Planck Institute of Molecular Plant Physiology, Am Muehlenberg 1, Potsdam-Golm, Brandenburg 14476, Germany REFERENCE 3 (bases 1 to 8289) TITLE Direct Submission REFERENCE 4 (bases 1 to 8289) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (25-JUN-2012) Organelle Biology, Biotechnology and Molecular Ecophysiology, Max Planck Institute of Molecular Plant Physiology, Am Muehlenberg 1, Potsdam-Golm, Brandenburg 14476, Germany" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..8289 /mol_type="other DNA" /organism="synthetic DNA construct" tRNA complement(31..104) /product="tRNA-Met" CDS complement(257..556) /gene="rps14" /label="Small ribosomal subunit protein uS14c" /note="Small ribosomal subunit protein uS14c from Nicotiana sylvestris. Accession#: Q3C1I0" gene complement(679..1878) /gene="psaB" /label="psaB" /note="derived from Nicotiana tabacum" promoter complement(1891..1909) /label="T7 promoter" /note="promoter for bacteriophage T7 RNA polymerase" primer_bind complement(1919..1935) /label="M13 fwd" /note="common sequencing primer, one of multiple similar variants" rep_origin 2077..2532 /label="f1 ori" /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" promoter 2558..2662 /label="AmpR promoter" CDS 2663..3520 /label="AmpR" /note="beta-lactamase" rep_origin 3694..4282 /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" protein_bind 4570..4591 /label="CAP binding site" /note="CAP binding activates transcription in the presence of cAMP." promoter 4606..4636 /label="lac promoter" /note="promoter for the E. coli lac operon" protein_bind 4644..4660 /label="lac operator" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." primer_bind 4668..4684 /label="M13 rev" /note="common sequencing primer, one of multiple similar variants" promoter 4705..4723 /label="T3 promoter" /note="promoter for bacteriophage T3 RNA polymerase" gene 4737..4867 /gene="psbZ" /label="psbZ" /note="derived from Nicotiana tabacum" tRNA 5143..5213 /product="tRNA-Gly" protein_bind 5406..5439 /label="loxP" /note="Cre-mediated recombination occurs in the 8-bp core sequence (ATGTATGC) (Shaw et al., 2021)." regulatory 5480..5614 /note="prrN promoter; derived from Nicotiana tabacum" /regulatory_class="promoter" CDS 5615..6403 /label="SmR" /note="aminoglycoside adenylyltransferase (Murphy, 1985)" regulatory 6417..6811 /note="psbA terminator; derived from Nicotiana tabacum" /regulatory_class="terminator" misc_recomb 6815..6848 /label="LoxP" /note="LoxP" protein_bind complement(6815..6848) /label="loxP" /bound_moiety="Cre recombinase" /note="Cre-mediated recombination occurs in the 8-bp core sequence (GCATACAT)." primer_bind 6878..6894 /label="KS primer" /note="common sequencing primer, one of multiple similar variants" regulatory complement(6897..7117) /note="rbcL terminator; derived from Nicotiana tabacum" /regulatory_class="terminator" CDS complement(7118..8071) /codon_start=1 /gene="TMT" /product="gamma-tocopherol methyltransferase" /label="TMT" /note="derived from Synechocystis sp. PCC 6803" /protein_id="AFQ99316.1" /translation="MVYHVRPKHALFLAFYCYFSLLTMASATIASADLYEKIKNFYDDS SGLWEDVWGEHMHHGYYGPHGTYRIDRRQAQIDLIKELLAWAVPQNSAKPRKILDLGCG IGGSSLYLAQQHQAEVMGASLSPVQVERAGERARALGLGSTCQFQVANALDLPFASDSF DWVWSLESGEHMPNKAQFLQEAWRVLKPGGRLILATWCHRPIDPGNGPLTADERRHLQA IYDVYCLPYVVSLPDYEAIARECGFGEIKTADWSVAVAPFWDRVIESAFDPRVLWALGQ AGPKIINAALCLRLMKWGYERGLVRFGLLTGIKPLV" gene complement(7118..8071) /gene="TMT" /label="TMT" /note="SyTMT" RBS complement(8079..8101) /label="RBS" /note="efficient ribosome binding site from bacteriophage T7 gene 10 (Olins and Rangwala, 1989)" promoter complement(8236..8254) /label="T3 promoter" /note="promoter for bacteriophage T3 RNA polymerase"
This page is informational only.