Basic Vector Information
- Vector Name:
- pSV71BlaMG2fmRK
- Antibiotic Resistance:
- Ampicillin
- Length:
- 10377 bp
- Type:
- Mammalian expression vector
- Replication origin:
- ori
- Source/Author:
- De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman Fonseca M, Vanhoucke M, Beyaert R.
pSV71BlaMG2fmRK vector Vector Map
pSV71BlaMG2fmRK vector Sequence
LOCUS V002927 10377 bp DNA circular SYN 18-DEC-2018 DEFINITION Exported. ACCESSION V002927 VERSION V002927 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 10377) AUTHORS De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman Fonseca M, Vanhoucke M, Beyaert R. TITLE BCCM/LMBP Plasmid collection JOURNAL Unpublished REFERENCE 2 (bases 1 to 10377) AUTHORS De Schamphelaire W. TITLE Direct Submission JOURNAL Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927, 9052, BELGIUM REFERENCE 3 (bases 1 to 10377) TITLE Direct Submission REFERENCE 4 (bases 1 to 10377) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927, 9052, BELGIUM" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..10377 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 82..439 /label="SV40 promoter" /note="SV40 enhancer and early promoter" CDS 453..974 /label="small t antigen" /note="SV40 (simian virus 40) small t antigen" intron 979..1044 /label="small t intron" /note="SV40 (simian virus 40) small t antigen intron" CDS 1174..1194 /label="SV40 NLS" /note="nuclear localization signal of SV40 (simian virus 40) large T antigen" polyA_signal 2948..3082 /label="SV40 poly(A) signal" /note="SV40 polyadenylation signal" misc_feature complement(3104..3194) /label="3' UTR of mIghg2b" /note="3' UTR of mIghg2b" CDS complement(3195..3914) /codon_start=1 /note="unnamed protein product; mIgG2b; fragment of heavy chain of mouse anti-hPLAP monoclonal antibody (MG2)" /protein_id="SJL88227.1" /translation="ELSGPTSTINPCPPCKECHKCPAPNLEGGPSVFIFPPNIKDVLMI SLTPKVTCVVVDVSEDDPDVQISWFVNNVEVLTAQTQTHREDYNSTIRVVSALPIQHQD WMSGKEFKCKVNNKDLPAPIERTISKIKGIVRAPQVYILSPPPEQLSRKDVSLTCLAVG FSPEDISVEWTSNGHTEENYKDTAPVLDSDGSYFVRSKLNMKTSKWEKTDSFSCNVRHE GLKNYYLKKTISRSPGK" CDS complement(3915..4772) /label="AmpR" /note="beta-lactamase" misc_feature complement(4886..5823) /label="intron" /note="intron" CDS complement(5830..6015) /note="Agnoprotein from Simian virus 40. Accession#: P03084" /label="Agnoprotein" promoter 6087..6416 /label="SV40 promoter" /note="SV40 enhancer and early promoter" CDS 6430..6951 /label="small t antigen" /note="SV40 (simian virus 40) small t antigen" CDS 7151..7171 /label="SV40 NLS" /note="nuclear localization signal of SV40 (simian virus 40) large T antigen" misc_feature 8226..8366 /label="bom" /note="basis of mobility region from pBR322" rep_origin complement(8552..9140) /direction=LEFT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(9485..10141) /label="CmR" /note="chloramphenicol acetyltransferase" promoter complement(10142..10244) /label="cat promoter" /note="promoter of the E. coli cat gene encoding chloramphenicol acetyltransferase"
This page is informational only.