Basic Vector Information
- Vector Name:
- pSV71BlahCH3E
- Antibiotic Resistance:
- Ampicillin
- Length:
- 10062 bp
- Type:
- Mammalian expression vector
- Replication origin:
- ori
- Source/Author:
- De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman Fonseca M, Vanhoucke M, Beyaert R.
- Promoter:
- SV40
pSV71BlahCH3E vector Vector Map
pSV71BlahCH3E vector Sequence
LOCUS V002934 10062 bp DNA circular SYN 18-DEC-2018 DEFINITION Exported. ACCESSION V002934 VERSION V002934 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 10062) AUTHORS De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman Fonseca M, Vanhoucke M, Beyaert R. TITLE BCCM/LMBP Plasmid collection JOURNAL Unpublished REFERENCE 2 (bases 1 to 10062) AUTHORS De Schamphelaire W. TITLE Direct Submission JOURNAL Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927, 9052, BELGIUM REFERENCE 3 (bases 1 to 10062) TITLE Direct Submission REFERENCE 4 (bases 1 to 10062) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927, 9052, BELGIUM" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..10062 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 82..439 /label="SV40 promoter" /note="SV40 enhancer and early promoter" CDS 453..974 /label="small t antigen" /note="SV40 (simian virus 40) small t antigen" intron 979..1044 /label="small t intron" /note="SV40 (simian virus 40) small t antigen intron" CDS 1174..1194 /label="SV40 NLS" /note="nuclear localization signal of SV40 (simian virus 40) large T antigen" polyA_signal 2948..3082 /label="SV40 poly(A) signal" /note="SV40 polyadenylation signal" misc_feature complement(3219..3257) /label="E-tag" /note="E-tag" CDS complement(3267..3584) /codon_start=1 /note="unnamed protein product; CH3" /protein_id="SJL88029.1" /translation="QPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQ PENNYNTTPPMLDSDGSFFLYSKLTVDKSRWQQGNIFSCSVMHEALHNRFTQKSLSLSP GK" CDS complement(3600..4457) /label="AmpR" /note="beta-lactamase" misc_feature complement(4571..5508) /label="intron" /note="intron" CDS complement(5515..5700) /note="Agnoprotein from Simian virus 40. Accession#: P03084" /label="Agnoprotein" promoter 5772..6101 /label="SV40 promoter" /note="SV40 enhancer and early promoter" CDS 6115..6636 /label="small t antigen" /note="SV40 (simian virus 40) small t antigen" CDS 6836..6856 /label="SV40 NLS" /note="nuclear localization signal of SV40 (simian virus 40) large T antigen" misc_feature 7911..8051 /label="bom" /note="basis of mobility region from pBR322" rep_origin complement(8237..8825) /direction=LEFT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(9170..9826) /label="CmR" /note="chloramphenicol acetyltransferase" promoter complement(9827..9929) /label="cat promoter" /note="promoter of the E. coli cat gene encoding chloramphenicol acetyltransferase"
This page is informational only.