pSV71BlahCH3E vector (V002934)

LOCUS       V002934                10062 bp    DNA     circular SYN 18-DEC-2018
DEFINITION  Exported.
ACCESSION   V002934
VERSION     V002934
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
            .
REFERENCE   1  (bases 1 to 10062)
  AUTHORS   De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman
            Fonseca M, Vanhoucke M, Beyaert R.
  TITLE     BCCM/LMBP Plasmid collection
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 10062)
  AUTHORS   De Schamphelaire W.
  TITLE     Direct Submission
  JOURNAL   Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent,
            Technologiepark 927, 9052, BELGIUM
REFERENCE   3  (bases 1 to 10062)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 10062)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName:
            "Unpublished"
            SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
            (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927,
            9052, BELGIUM"
            SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..10062
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     promoter        82..439
                     /label="SV40 promoter"
                     /note="SV40 enhancer and early promoter"
     CDS             453..974
                     /label="small t antigen"
                     /note="SV40 (simian virus 40) small t antigen"
     intron          979..1044
                     /label="small t intron"
                     /note="SV40 (simian virus 40) small t antigen intron"
     CDS             1174..1194
                     /label="SV40 NLS"
                     /note="nuclear localization signal of SV40 (simian virus
                     40) large T antigen"
     polyA_signal    2948..3082
                     /label="SV40 poly(A) signal"
                     /note="SV40 polyadenylation signal"
     misc_feature    complement(3219..3257)
                     /label="E-tag"
                     /note="E-tag"
     CDS             complement(3267..3584)
                     /codon_start=1
                     /note="unnamed protein product; CH3"
                     /protein_id="SJL88029.1"
                     /translation="QPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQ
                     PENNYNTTPPMLDSDGSFFLYSKLTVDKSRWQQGNIFSCSVMHEALHNRFTQKSLSLSP
                     GK"
     CDS             complement(3600..4457)
                     /label="AmpR"
                     /note="beta-lactamase"
     misc_feature    complement(4571..5508)
                     /label="intron"
                     /note="intron"
     CDS             complement(5515..5700)
                     /note="Agnoprotein from Simian virus 40. Accession#:
                     P03084"
                     /label="Agnoprotein"
     promoter        5772..6101
                     /label="SV40 promoter"
                     /note="SV40 enhancer and early promoter"
     CDS             6115..6636
                     /label="small t antigen"
                     /note="SV40 (simian virus 40) small t antigen"
     CDS             6836..6856
                     /label="SV40 NLS"
                     /note="nuclear localization signal of SV40 (simian virus
                     40) large T antigen"
     misc_feature    7911..8051
                     /label="bom"
                     /note="basis of mobility region from pBR322"
     rep_origin      complement(8237..8825)
                     /direction=LEFT
                     /label="ori"
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
                     replication"
     CDS             complement(9170..9826)
                     /label="CmR"
                     /note="chloramphenicol acetyltransferase"
     promoter        complement(9827..9929)
                     /label="cat promoter"
                     /note="promoter of the E. coli cat gene encoding
                     chloramphenicol acetyltransferase"