Basic Vector Information
- Vector Name:
- pSV5HIFNG1
- Antibiotic Resistance:
- Ampicillin
- Length:
- 7729 bp
- Type:
- Mammalian expression vector
- Replication origin:
- ori
- Source/Author:
- De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman Fonseca M, Vanhoucke M, Beyaert R.
- Promoter:
- SV40
pSV5HIFNG1 vector Map
pSV5HIFNG1 vector Sequence
LOCUS V002938 7729 bp DNA circular SYN 18-DEC-2018 DEFINITION Exported. ACCESSION V002938 VERSION V002938 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 7729) AUTHORS De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman Fonseca M, Vanhoucke M, Beyaert R. TITLE BCCM/LMBP Plasmid collection JOURNAL Unpublished REFERENCE 2 (bases 1 to 7729) AUTHORS De Schamphelaire W. TITLE Direct Submission JOURNAL Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927, 9052, BELGIUM REFERENCE 3 (bases 1 to 7729) TITLE Direct Submission REFERENCE 4 (bases 1 to 7729) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927, 9052, BELGIUM" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..7729 /mol_type="other DNA" /organism="synthetic DNA construct" CDS complement(629..1029) /codon_start=1 /note="unnamed protein product; part of SV40 small t-antigen" /protein_id="SJL88696.1" /translation="MDKVLNREESLQLMDLLGLERSAWGNIPLMRKAYLKKCKEFHPDK GGDEEKMKKMNTLYKKMEDGVKYAHQPDFGGFWDATEVFASSLNPGVDAMYCKQWPECA KKMSANCICLLCLLRMKHENRKLYRKDPP" promoter complement(1043..1400) /label="SV40 promoter" /note="SV40 enhancer and early promoter" CDS 1444..1629 /note="Agnoprotein from Simian virus 40. Accession#: P03084" /label="Agnoprotein" misc_feature 1636..2573 /label="intron" /note="intron" CDS 2670..3167 /gene="IFNG" /label="Interferon gamma" /note="Interferon gamma from Homo sapiens. Accession#: P01579" polyA_signal complement(3453..3587) /label="SV40 poly(A) signal" /note="SV40 polyadenylation signal" polyA_signal complement(4129..4177) /label="HSV TK poly(A) signal" /note="herpes simplex virus thymidine kinase polyadenylation signal (Cole and Stacy, 1985)" CDS complement(4222..5256) /label="HygR" /note="hygromycin B phosphotransferase" promoter complement(5300..5445) /label="HSV TK promoter" /note="herpes simplex virus thymidine kinase promoter" rep_origin complement(5902..6490) /direction=LEFT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(6664..7521) /label="AmpR" /note="beta-lactamase" promoter complement(7522..7626) /label="AmpR promoter"
This page is informational only.