Basic Vector Information
- Vector Name:
- pSV51E6Hf2
- Antibiotic Resistance:
- Ampicillin
- Length:
- 9574 bp
- Type:
- Mammalian expression vector
- Replication origin:
- ori
- Source/Author:
- De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman Fonseca M, Vanhoucke M, Beyaert R.
pSV51E6Hf2 vector Map
pSV51E6Hf2 vector Sequence
LOCUS V002956 9574 bp DNA circular SYN 18-DEC-2018 DEFINITION Exported. ACCESSION V002956 VERSION V002956 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 9574) AUTHORS De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman Fonseca M, Vanhoucke M, Beyaert R. TITLE BCCM/LMBP Plasmid collection JOURNAL Unpublished REFERENCE 2 (bases 1 to 9574) AUTHORS De Schamphelaire W. TITLE Direct Submission JOURNAL Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927, 9052, BELGIUM REFERENCE 3 (bases 1 to 9574) TITLE Direct Submission REFERENCE 4 (bases 1 to 9574) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927, 9052, BELGIUM" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..9574 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 82..439 /label="SV40 promoter" /note="SV40 enhancer and early promoter" CDS 453..974 /label="small t antigen" /note="SV40 (simian virus 40) small t antigen" intron 979..1044 /label="small t intron" /note="SV40 (simian virus 40) small t antigen intron" CDS 1174..1194 /label="SV40 NLS" /note="nuclear localization signal of SV40 (simian virus 40) large T antigen" polyA_signal 2948..3082 /label="SV40 poly(A) signal" /note="SV40 polyadenylation signal" CDS complement(3112..3912) /codon_start=1 /note="unnamed protein product; mIghg2b; fragment of heavy chain of mouse anti-hPLAP monoclonal antibody (E6H)" /protein_id="SJL89005.1" /translation="MEWIWIFLFILSGTAGVQSQVQLQQSGAELARPGASVKLSCKASG YTLTSYGISWVKQRTGQGLEWIGEIYPGSGNSYFNEKFKGKATLTVDKSSSTAYLHLSS LTSEDSAVYFCAGPRQVGLLPFGYWGQGTLVTASAAKTTPPSVYPLAPGCGDTTGSSVT LGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSQTVTCS VAHPASSTTVDKKLEPSGPTSTINPCPPCKECHKCPAPNLDLVN" misc_feature complement(4081..5018) /label="intron" /note="intron" CDS complement(5025..5210) /note="Agnoprotein from Simian virus 40. Accession#: P03084" /label="Agnoprotein" promoter 5282..5611 /label="SV40 promoter" /note="SV40 enhancer and early promoter" CDS 5625..6146 /label="small t antigen" /note="SV40 (simian virus 40) small t antigen" CDS 6346..6366 /label="SV40 NLS" /note="nuclear localization signal of SV40 (simian virus 40) large T antigen" misc_feature 7421..7561 /label="bom" /note="basis of mobility region from pBR322" rep_origin complement(7747..8335) /direction=LEFT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(8509..9366) /label="AmpR" /note="beta-lactamase" promoter complement(9367..9471) /label="AmpR promoter"
This page is informational only.