Basic Vector Information
- Vector Name:
- pSV25ShTNFR75m5
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5487 bp
- Type:
- Mammalian expression vector
- Replication origin:
- ori
- Source/Author:
- De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman Fonseca M, Vanhoucke M, Beyaert R.
- Promoter:
- SV40
pSV25ShTNFR75m5 vector Map
pSV25ShTNFR75m5 vector Sequence
LOCUS 40924_41724 5487 bp DNA circular SYN 18-DEC-2018 DEFINITION Mammalian expression vector pSV25ShTNFR75m5, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5487) AUTHORS De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman Fonseca M, Vanhoucke M, Beyaert R. TITLE BCCM/LMBP Plasmid collection JOURNAL Unpublished REFERENCE 2 (bases 1 to 5487) AUTHORS De Schamphelaire W. TITLE Direct Submission JOURNAL Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927, 9052, BELGIUM REFERENCE 3 (bases 1 to 5487) TITLE Direct Submission REFERENCE 4 (bases 1 to 5487) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927, 9052, BELGIUM" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..5487 /mol_type="other DNA" /organism="synthetic DNA construct" polyA_signal complement(750..884) /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" CDS complement(1309..1329) /label=SV40 NLS /note="nuclear localization signal of SV40 (simian virus 40) large T antigen" intron complement(1459..1524) /label=small t intron /note="SV40 (simian virus 40) small t antigen intron" CDS complement(1526..1600) /codon_start=1 /note="unnamed protein product; part of SV40 small t-antigen" /protein_id="SJL87717.1" /translation="DLCEGTLLLWCDIIGQTTYRDLKL" CDS complement(1620..2828) /codon_start=1 /note="unnamed protein product; R75m5" /protein_id="SJL87718.1" /translation="MPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFC TKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYC ALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQIC NVVAIPGNASMDAVCTSTSPTRSMAPGAVHLPQPVSTRSQHTQPTPEPSTAPSTSFLLP MGPSPPAEGSTGDFALPVGLIVGVTALGLLIIGVVNCVIMTQVKKKPLCLQREAKVPHL PADKARGTQGPEQQHLLITAPSSSSSSLESSASALDRRAPTRNQPQAPGVEASGAGEAR ASTGSSDSSPGGHGTQVNVTCIVNVCSSSDHSSQCSSQASSTMGDTDSSPSESPKDEQV PFS" misc_feature complement(2829..2894) /label=sTNFR /note="sTNFR" regulatory 2891..2900 /note="vertebrate consensus sequence for strong initiation of translation (Kozak, 1987)" /regulatory_class="other" promoter complement(2916..3245) /label=SV40 promoter /note="SV40 enhancer and early promoter" rep_origin complement(3660..4248) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(4422..5279) /label=AmpR /note="beta-lactamase" promoter complement(5280..5384) /label=AmpR promoter
This page is informational only.