Basic Vector Information
- Vector Name:
- pSV25ShTNFR75m2
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5598 bp
- Type:
- Mammalian expression vector
- Replication origin:
- ori
- Source/Author:
- De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman Fonseca M, Vanhoucke M, Beyaert R.
- Promoter:
- SV40
pSV25ShTNFR75m2 vector Map
pSV25ShTNFR75m2 vector Sequence
LOCUS 40924_41709 5598 bp DNA circular SYN 18-DEC-2018
DEFINITION Mammalian expression vector pSV25ShTNFR75m2, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 5598)
AUTHORS De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman
Fonseca M, Vanhoucke M, Beyaert R.
TITLE BCCM/LMBP Plasmid collection
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 5598)
AUTHORS De Schamphelaire W.
TITLE Direct Submission
JOURNAL Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent,
Technologiepark 927, 9052, BELGIUM
REFERENCE 3 (bases 1 to 5598)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 5598)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName:
"Unpublished"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927,
9052, BELGIUM"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..5598
/mol_type="other DNA"
/organism="synthetic DNA construct"
polyA_signal complement(750..884)
/label=SV40 poly(A) signal
/note="SV40 polyadenylation signal"
CDS complement(1309..1329)
/label=SV40 NLS
/note="nuclear localization signal of SV40 (simian virus
40) large T antigen"
intron complement(1459..1524)
/label=small t intron
/note="SV40 (simian virus 40) small t antigen intron"
CDS complement(1526..1600)
/codon_start=1
/note="unnamed protein product; part of SV40 small
t-antigen"
/protein_id="SJL87705.1"
/translation="DLCEGTLLLWCDIIGQTTYRDLKL"
CDS complement(2127..2939)
/codon_start=1
/note="unnamed protein product; R75m2"
/protein_id="SJL87706.1"
/translation="MPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFC
TKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYC
ALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQIC
NVVAIPGNASMDAVCTSTSPTRSMAPGAVHLPQPVSTRSQHTQPTPEPSTAPSTSFLLP
MGPSPPAEGSTGDFALPVGLIVGVTALGLLIIGVVNCVIMTQVKKKPL"
misc_feature complement(2940..3005)
/label=sTNFR
/note="sTNFR"
regulatory 3002..3011
/note="vertebrate consensus sequence for strong initiation
of translation (Kozak, 1987)"
/regulatory_class="other"
promoter complement(3027..3356)
/label=SV40 promoter
/note="SV40 enhancer and early promoter"
rep_origin complement(3771..4359)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(4533..5390)
/label=AmpR
/note="beta-lactamase"
promoter complement(5391..5495)
/label=AmpR promoter
This page is informational only.