Basic Vector Information
- Vector Name:
- pSV23SmIL6mTNF
- Antibiotic Resistance:
- Ampicillin
- Length:
- 4995 bp
- Type:
- Mammalian expression vector
- Replication origin:
- ori
- Source/Author:
- De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman Fonseca M, Vanhoucke M, Beyaert R.
- Promoter:
- SV40
pSV23SmIL6mTNF vector Map
pSV23SmIL6mTNF vector Sequence
LOCUS 40924_41624 4995 bp DNA circular SYN 18-DEC-2018 DEFINITION Mammalian expression vector pSV23SmIL6mTNF, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4995) AUTHORS De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman Fonseca M, Vanhoucke M, Beyaert R. TITLE BCCM/LMBP Plasmid collection JOURNAL Unpublished REFERENCE 2 (bases 1 to 4995) AUTHORS De Schamphelaire W. TITLE Direct Submission JOURNAL Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927, 9052, BELGIUM REFERENCE 3 (bases 1 to 4995) TITLE Direct Submission REFERENCE 4 (bases 1 to 4995) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927, 9052, BELGIUM" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..4995 /mol_type="other DNA" /organism="synthetic DNA construct" polyA_signal complement(750..884) /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" CDS complement(1309..1329) /label=SV40 NLS /note="nuclear localization signal of SV40 (simian virus 40) large T antigen" intron complement(1459..1524) /label=small t intron /note="SV40 (simian virus 40) small t antigen intron" CDS complement(1526..1600) /codon_start=1 /note="unnamed protein product; part of SV40 small t-antigen" /protein_id="SJL88606.1" /translation="DLCEGTLLLWCDIIGQTTYRDLKL" misc_feature complement(1608..1857) /label=3' UTR of mTNF /note="3' UTR of mTNF" CDS complement(1858..2328) /codon_start=1 /note="unnamed protein product; mTNF mature sequence" /protein_id="SJL88607.1" /translation="LRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKD NQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDT PEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL" CDS complement(2329..2400) /codon_start=1 /note="unnamed protein product; mutated mIL6 signal sequence" /protein_id="SJL88608.1" /translation="MKFLSARDFHPVAFLGLMLVTTTA" promoter complement(2443..2740) /label=SV40 promoter /note="SV40 enhancer and early promoter" rep_origin complement(3168..3756) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(3930..4787) /label=AmpR /note="beta-lactamase" promoter complement(4788..4892) /label=AmpR promoter
This page is informational only.