pSV23SE6Hf1 vector (V002991)

LOCUS       40924_41579        4924 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Mammalian expression vector pSV23SE6Hf1, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 4924)
  AUTHORS   De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman 
            Fonseca M, Vanhoucke M, Beyaert R.
  TITLE     BCCM/LMBP Plasmid collection
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 4924)
  AUTHORS   De Schamphelaire W.
  TITLE     Direct Submission
  JOURNAL   Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent, 
            Technologiepark 927, 9052, BELGIUM
REFERENCE   3  (bases 1 to 4924)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 4924)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: 
            "Unpublished"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927, 
            9052, BELGIUM"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..4924
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     polyA_signal    complement(750..884)
                     /label=SV40 poly(A) signal
                     /note="SV40 polyadenylation signal"
     CDS             complement(1309..1329)
                     /label=SV40 NLS
                     /note="nuclear localization signal of SV40 (simian virus
                     40) large T antigen"
     intron          complement(1459..1524)
                     /label=small t intron
                     /note="SV40 (simian virus 40) small t antigen intron"
     CDS             complement(1526..1600)
                     /codon_start=1
                     /note="unnamed protein product; part of SV40 small
                     t-antigen"
                     /protein_id="SJL88970.1"
                     /translation="DLCEGTLLLWCDIIGQTTYRDLKL"
     CDS             complement(1609..2331)
                     /codon_start=1
                     /note="unnamed protein product; mIghg2b; fragment of heavy
                     chain of mouse anti-hPLAP monoclonal antibody (E6H)"
                     /protein_id="SJL88971.1"
                     /translation="MEWIWIFLFILSGTAGVQSQVQLQQSGAELARPGASVKLSCKASG
                     YTLTSYGISWVKQRTGQGLEWIGEIYPGSGNSYFNEKFKGKATLTVDKSSSTAYLHLSS
                     LTSEDSAVYFCAGPRQVGLLPFGYWGQGTLVTASAAKTTPPSVYPLAPGCGDTTGSSVT
                     LGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSQTVTCS
                     VAHPASSTTVDKKLEPSV"
     promoter        complement(2353..2682)
                     /label=SV40 promoter
                     /note="SV40 enhancer and early promoter"
     rep_origin      complement(3097..3685)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(3859..4716)
                     /label=AmpR
                     /note="beta-lactamase"
     promoter        complement(4717..4821)
                     /label=AmpR promoter