Basic Vector Information
- Vector Name:
- pSUMO3_ck5
- Antibiotic Resistance:
- Kanamycin
- Length:
- 5597 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Kegler C.
pSUMO3_ck5 vector Map
pSUMO3_ck5 vector Sequence
LOCUS 40924_41420 5597 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pSUMO3_ck5, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5597) AUTHORS Kegler C. TITLE A multifunctional enzyme is involved in bacterial ether lipid biosynthesis JOURNAL Unpublished REFERENCE 2 (bases 1 to 5597) AUTHORS Kegler C. TITLE Direct Submission JOURNAL Submitted (28-MAR-2014) Molekulare Biotechnologie / Institut fur Molekulare Biowissenschaften, Goethe Universtaet Frankfurt, Max-von-Laue Strasse 9, Frankfurt am Main, Hessen 60438, Germany REFERENCE 3 (bases 1 to 5597) TITLE Direct Submission REFERENCE 4 (bases 1 to 5597) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (28-MAR-2014) Molekulare Biotechnologie / Institut fur Molekulare Biowissenschaften, Goethe Universtaet Frankfurt, Max-von-Laue Strasse 9, Frankfurt am Main, Hessen 60438, Germany" COMMENT SGRef: number: 3; type: "Journal Article" COMMENT ##Assembly-Data-START## Assembly Method :: ??? v. ??? Sequencing Technology :: unknown ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..5597 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 7..24 /codon_start=1 /label=6xHis /note="6xHis affinity tag" /translation="HHHHHH" CDS 31..306 /codon_start=1 /label=SUMO3 /note="human small ubiquitin-related modifier 3" /translation="LQEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKA YCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG" CDS 371..388 /codon_start=1 /label=6xHis /note="6xHis affinity tag" /translation="HHHHHH" terminator 455..502 /label=T7 terminator /note="transcription terminator for bacteriophage T7 RNA polymerase" rep_origin 539..994 /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" CDS complement(1090..1902) /codon_start=1 /label=KanR /note="aminoglycoside phosphotransferase" /translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG KPDAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF" rep_origin 2024..2612 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" misc_feature complement(2798..2940) /label=bom /note="basis of mobility region from pBR322" CDS complement(3045..3233) /codon_start=1 /label=rop /note="Rop protein, which maintains plasmids at low copy number" /translation="VTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHA DELYRSCLARFGDDGENL" protein_bind complement(4008..4029) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." CDS complement(4045..5124) /codon_start=1 /label=lacI /note="lac repressor" /translation="VKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAEL NYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGV EACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSIIFSH EDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSA MSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSC YIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPNTQTASPR ALADSLMQLARQVSRLESGQ" promoter complement(5125..5202) /label=lacI promoter promoter 5511..5529 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" protein_bind 5530..5554 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." RBS 5569..5591 /label=RBS /note="efficient ribosome binding site from bacteriophage T7 gene 10 (Olins and Rangwala, 1989)"
This page is informational only.