Basic Vector Information
- Vector Name:
- pSTNSK-Tp
- Length:
- 10870 bp
- Type:
- Tn7 transposase expression vector
- Replication origin:
- pSC101 ori
- Source/Author:
- Crepin S, Harel J, Dozois CM.
- Promoter:
- Pc
pSTNSK-Tp vector Vector Map
pSTNSK-Tp vector Sequence
LOCUS V003025 10870 bp DNA circular SYN 18-DEC-2018 DEFINITION Exported. ACCESSION V003025 VERSION V003025 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 10870) AUTHORS Crepin S, Harel J, Dozois CM. TITLE Chromosomal complementation using Tn7 transposon vectors in Enterobacteriaceae JOURNAL Appl. Environ. Microbiol. 78 (17), 6001-6008 (2012) PUBMED 22706059 REFERENCE 2 (bases 1 to 10870) AUTHORS Crepin S, Harel J, Dozois CM. TITLE Direct Submission JOURNAL Submitted (24-JAN-2012) Microbiology and Biothechnology, INRS-Institut Armand-Frappier, 531, boul. des Prairies, Laval, Quebec H7V 1B7, Canada REFERENCE 3 (bases 1 to 10870) TITLE Direct Submission REFERENCE 4 (bases 1 to 10870) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Appl. Environ. Microbiol."; date: "2012"; volume: "78"; issue: "17"; pages: "6001-6008" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (24-JAN-2012) Microbiology and Biothechnology, INRS-Institut Armand-Frappier, 531, boul. des Prairies, Laval, Quebec H7V 1B7, Canada" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..10870 /mol_type="other DNA" /organism="synthetic DNA construct" CDS complement(281..1807) /codon_start=1 /gene="tnsD" /product="Tn7 transposase subunit" /label="tnsD" /protein_id="AFM78104.1" /translation="MRNFPVPYSNELIYSTIARAGVYQGIVSPKQLLDEVYGNRKVVAT LGLPSHLGVIARHLHQTGRYAVQQLIYEHTLFPLYAPFVGKERRDEAIRLMEYQAQGAV HLMLGVAASRVKSDNRFRYCPDCVALQLNRYGEAFWQRDWYLPALPYCPKHGALVFFDR AVDDHRHQFWALGHTELLSDYPKDSLSQLTALAAYIAPLLDAPRAQELSPSLEQWTLFY QRLAQDLGLTKSKHIRHDLVAERVRQTFSDEALEKLDLKLAENKDTCWLKSIFRKHRKA FSYLQHSIVWQALLPKLTVIEALQQASALTEHSITTRPVSQSVQPNSEDLSVKHKDWQQ LVHKYQGIKAARQSLEGGVLYAWLYRHDRDWLVHWNQQHQQERLAPAPRVDWNQRDRIA VRQLLRIIKRLDSSLDHPRATSSWLLKQTPNGTSLAKNLQKLPLVALCLKRYSESVEDY QIRRISQAFIKLKQEDVELRRWRLLRSATLSKERITEEAQRFLEMVYGEE" gene complement(281..1807) /gene="tnsD" /label="tnsD" CDS complement(1813..3477) /gene="tnsC" /label="Transposon Tn7 transposition protein TnsC" /note="Transposon Tn7 transposition protein TnsC from Escherichia coli. Accession#: P05846" CDS complement(3477..5582) /gene="tnsB" /label="Transposon Tn7 transposition protein TnsB" /note="Transposon Tn7 transposition protein TnsB from Escherichia coli. Accession#: P13989" mobile_element 6300..6524 /label="Tn7R" /note="mini-Tn7 element (right end of the Tn7 transposon)" protein_bind 6735..6782 /label="FRT" /note="FLP-mediated recombination occurs in the 8-bp core sequence TCTAGAAA (Turan and Bode, 2011)." CDS complement(6847..7080) /label="TpR" /note="E. coli plasmid-associated dihydrofolate reductase" promoter complement(7407..7435) /label="Pc promoter" /note="class 1 integron promoter" misc_recomb 7487..7534 /note="FRT; Flp recombinase target site" protein_bind 7487..7534 /label="FRT" /bound_moiety="FLP recombinase from the Saccharomyces cerevisiae 2u plasmid" /note="FLP-mediated recombination occurs in the 8-bp core sequence TCTAGAAA (Turan and Bode, 2011)." promoter complement(7596..7614) /label="T7 promoter" /note="promoter for bacteriophage T7 RNA polymerase" protein_bind complement(7650..7683) /label="FRT (minimal)" /note="supports FLP-mediated excision but not integration (Turan and Bode, 2011)" CDS 7851..8642 /label="NeoR/KanR" /note="aminoglycoside phosphotransferase" rep_origin 9511..9733 /label="pSC101 ori" /note="low-copy replication origin that requires the Rep101 protein" CDS 9781..10728 /label="Rep101(Ts)" /note="temperature-sensitive version of the RepA protein needed for replication with the pSC101 origin (Armstrong et al., 1984)"
This page is informational only.