Basic Vector Information
- Vector Name:
- pSRFPS1
- Length:
- 4755 bp
- Type:
- Reporter vector
- Replication origin:
- R6K γ ori
- Source/Author:
- Rodriguez MD, Paul Z, Wood CE, Rice KC, Triplett EW.
pSRFPS1 vector Map
pSRFPS1 vector Sequence
LOCUS V003046 4755 bp DNA circular SYN 18-DEC-2018 DEFINITION Exported. ACCESSION V003046 VERSION V003046 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 4755) AUTHORS Rodriguez MD, Paul Z, Wood CE, Rice KC, Triplett EW. TITLE Construction of Stable Fluorescent Reporter Plasmids for Use in Staphylococcus aureus JOURNAL Front Microbiol 8, 2491 (2017) PUBMED 29312199 REFERENCE 2 (bases 1 to 4755) AUTHORS Rodriguez MD. TITLE Direct Submission JOURNAL Submitted (24-AUG-2017) Microbiology and Cell Science, University of Florida, 1355 Museum Rd., PO Box 110700, Gainesville, FL 32611-0700, USA REFERENCE 3 (bases 1 to 4755) TITLE Direct Submission REFERENCE 4 (bases 1 to 4755) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Front Microbiol 8, 2491 (2017)" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (24-AUG-2017) Microbiology and Cell Science, University of Florida, 1355 Museum Rd., PO Box 110700, Gainesville, FL 32611-0700, USA" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..4755 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 1..996 /codon_start=1 /gene="repF" /product="RepF" /label="repF" /protein_id="AUS76875.1" /translation="MQYNTTRSITENQDNKTLKDMTKSGKQRPWREKKIDNVSYADILE ILKIKKAFNVKQCGNILEFKPTDEGYLKLHKTWFCKSKLCPVCNWRRAMKNSYQAQKVI EKVIKEKPKARWLFLTLSTKNAIDGDTLEQSLKHLTKAFDRLSRYKKVKQNLVGFMRST EVTVNKNDGSYNQHMHVLLCVENAYFRKKENYITQEEWVNLWQRALQVDYRPVANVKAI KPNRKGDKDIESAIKETSKYSVKSSDFLTDDDEKNQEIVSDLEKGLYRKRMLSYGGLLK QKHKILNLDDVEDGNLINASDEDKTTDEEEKAHSITAIWNFEKQNYYLRH" gene 1..996 /gene="repF" /label="repF" rep_origin 1179..1567 /label="R6K gamma ori" /note="gamma replication origin from E. coli plasmid R6K; requires the R6K initiator protein pi for replication" regulatory 1580..1824 /label="sarA P1 promoter" /note="sarA P1 promoter" /regulatory_class="promoter" CDS 1847..2329 /gene="dfrA" /label="Dihydrofolate reductase type 1" /note="Dihydrofolate reductase type 1 from Tn4003 from Staphylococcus aureus. Accession#: P13955" CDS 2367..3041 /label="DsRed-Express" /note="rapidly maturing tetrameric variant of DsRed fluorescent protein (Bevis and Glick, 2002)" regulatory 3481..3838 /label="atl transcription terminator" /note="atl transcription terminator" /regulatory_class="terminator" rep_origin 3935..4112 /label="sso" /note="sso" CDS complement(4333..4344) /label="WELQut site" /note="WELQut protease recognition and cleavage site" misc_feature 4581..4601 /label="dso" /note="dso"
This page is informational only.