Basic Vector Information
- Vector Name:
- pSRalphapuroG
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5936 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Allard V, de Leseleuc L, Denis F.
- Promoter:
- SRα
pSRalphapuroG vector Vector Map
pSRalphapuroG vector Sequence
LOCUS 40924_41245 5936 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pSRalphapuroG, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5936) AUTHORS Allard V, de Leseleuc L, Denis F. TITLE A family of mammalian expression vectors with different selection markers JOURNAL Unpublished REFERENCE 2 (bases 1 to 5936) AUTHORS Allard V, de Leseleuc L, Denis F. TITLE Direct Submission JOURNAL Submitted (01-MAY-2004) INRS-Institut Armand-Frappier, 531 Boulevard des Prairies, Laval, Quebec H7V 1B7, Canada REFERENCE 3 (bases 1 to 5936) TITLE Direct Submission REFERENCE 4 (bases 1 to 5936) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (01-MAY-2004) INRS-Institut Armand-Frappier, 531 Boulevard des Prairies, Laval, Quebec H7V 1B7, Canada" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..5936 /mol_type="other DNA" /organism="synthetic DNA construct" misc_feature 100..686 /label=IRES2 /note="internal ribosome entry site (IRES) of the encephalomyocarditis virus (EMCV)" misc_feature 786..1358 /label=IRES /note="internal ribosome entry site (IRES) of the encephalomyocarditis virus (EMCV)" CDS 1381..2097 /codon_start=1 /label=hrGFP /note="humanized Renilla green fluorescent protein" /translation="MVSKQILKNTGLQEIMSFKVNLEGVVNNHVFTMEGCGKGNILFGN QLVQIRVTKGAPLPFAFDILSPAFQYGNRTFTKYPEDISDFFIQSFPAGFVYERTLRYE DGGLVEIRSDINLIEEMFVYRVEYKGRNFPNDGPVMKKTITGLQPSFEVVYMNDGVLVG QVILVYRLNSGKFYSCHMRTLMKSKGVVKDFPEYHFIQHRLEKTYVEDGGFVEQHETAI AQLTSLGKPLGSLHEWV" polyA_signal complement(2144..2278) /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" CDS complement(2352..2948) /codon_start=1 /label=PuroR /note="puromycin N-acetyltransferase" /translation="MTEYKPTVRLATRDDVPRAVRTLAAAFADYPATRHTLDPDRHIER VTELQELFLTRVGLDIGKVWVADDGAAVAVWTTPESVEAGAVFAEIGPRMAELSGSRLA AQQQMEGLLAPHRPKEPAWFLATVGVSPDHQGKGLGSAVVLPGVEAAERAGVPAFLETS APRNLPFYERLGFTVTADVEVPEGPRTWCMTRKPGA" promoter complement(2958..3287) /label=SV40 promoter /note="SV40 enhancer and early promoter" promoter 3322..3426 /label=AmpR promoter CDS 3427..4284 /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS LIKHW" rep_origin 4458..5046 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" promoter 5308..5921 /label=SR-alpha promoter /note="hybrid promoter consisting of the SV40 early promoter plus part of the long terminal repeat of human T-lymphotrophic virus 1"
This page is informational only.