pSOS94 vector (V003089)

LOCUS       V003089                 7000 bp    DNA     circular SYN 18-DEC-2018
DEFINITION  Exported.
ACCESSION   V003089
VERSION     V003089
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
            .
REFERENCE   1  (bases 1 to 7000)
  AUTHORS   Desai RP, Papoutsakis ET.
  TITLE     Antisense RNA strategies for metabolic engineering of Clostridium
            acetobutylicum
  JOURNAL   J. Bacteriol. 65, 936-945 (1999)
REFERENCE   2  (bases 1 to 7000)
  AUTHORS   Soucaille P, Papoutsakis ET.
  TITLE     Clostridium acetobutylicum vectors using three clostridial
            promoters: expression of synthetic acetone-pathway operons and
            antisense RNA production
  JOURNAL   Unpublished
REFERENCE   3  (bases 1 to 7000)
  AUTHORS   Soucaille P, Papoutsakis ET.
  TITLE     Direct Submission
  JOURNAL   Submitted (25-NOV-2002) Laboratoire de Biotechnologie-Bioprocedes,
            UMR CNRS 5504, UR INRA 792, INSA, 135, avenue de Rangueil, Toulouse
            31077, France
REFERENCE   4  (bases 1 to 7000)
  TITLE     Direct Submission
REFERENCE   5  (bases 1 to 7000)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "J.
            Bacteriol. 65, 936-945 (1999)"
            SGRef: number: 2; type: "Journal Article"; journalName:
            "Unpublished"
            SGRef: number: 3; type: "Journal Article"; journalName: "Submitted
            (25-NOV-2002) Laboratoire de Biotechnologie-Bioprocedes, UMR CNRS
            5504, UR INRA 792, INSA, 135, avenue de Rangueil, Toulouse 31077,
            France"
            SGRef: number: 4; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..7000
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     primer_bind     381..397
                     /label="M13 fwd"
                     /note="common sequencing primer, one of multiple similar
                     variants"
     CDS             complement(465..905)
                     /codon_start=1
                     /gene="repL"
                     /product="RepL"
                     /label="repL"
                     /note="Bacillus subtilis plasmid pIM13 replication protein"
                     /protein_id="AAO39983.1"
                     /translation="MKERYGTVYKGSQRLIDEESGEVIEVDKLYRKQTSGNFVKAYIVQ
                     LISMLDMIGGKKLKIVNYILDNVHLSNNTMIATTREIAKATGTSLQTVITTLKILEEGN
                     IIKRKTGVLMLNPELLMRGDDQKQKYLLLEFGNFEQEANEID"
     gene            complement(465..905)
                     /gene="repL"
                     /label="repL"
     CDS             complement(1356..2087)
                     /gene="ermC'"
                     /label="rRNA adenine N-6-methyltransferase"
                     /note="rRNA adenine N-6-methyltransferase from Bacillus
                     subtilis. Accession#: P13956"
     regulatory      2450..2590
                     /label="Clostridium acetobutylicum ATCC824 ptb promoter"
                     /note="Clostridium acetobutylicum ATCC824 ptb promoter"
                     /regulatory_class="promoter"
     CDS             2618..3271
                     /gene="ctfA"
                     /label="Acetoacetyl-CoA:acetate/butyrate CoA transferase
                     alpha subunit"
                     /note="Acetoacetyl-CoA:acetate/butyrate CoA transferase
                     alpha subunit from Clostridium acetobutylicum (strain ATCC
                     824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787).
                     Accession#: P33752"
     CDS             3276..3938
                     /gene="ctfB"
                     /label="Acetoacetyl-CoA:acetate/butyrate CoA-transferase
                     beta subunit"
                     /note="Acetoacetyl-CoA:acetate/butyrate CoA-transferase
                     beta subunit from Clostridium acetobutylicum (strain ATCC
                     824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787).
                     Accession#: P23673"
     CDS             3974..4705
                     /gene="adc"
                     /label="Acetoacetate decarboxylase"
                     /note="Acetoacetate decarboxylase from Clostridium
                     acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG
                     5710 / VKM B-1787). Accession#: P23670"
     primer_bind     complement(4779..4795)
                     /label="M13 rev"
                     /note="common sequencing primer, one of multiple similar
                     variants"
     protein_bind    complement(4803..4819)
                     /label="lac operator"
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be
                     relieved by adding lactose or
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(4827..4857)
                     /label="lac promoter"
                     /note="promoter for the E. coli lac operon"
     protein_bind    complement(4872..4893)
                     /label="CAP binding site"
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     rep_origin      complement(5181..5769)
                     /direction=LEFT
                     /label="ori"
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
                     replication"
     CDS             complement(5943..6800)
                     /label="AmpR"
                     /note="beta-lactamase"
     promoter        complement(6801..6905)
                     /label="AmpR promoter"