Basic Vector Information
- Vector Name:
- PSM2
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 6504 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Rahnama M, Forester N, Ariyawansa S, Voisey CR, Johnson LJ, Johnson RD, Fleetwood DJ.
PSM2 vector Map
PSM2 vector Sequence
LOCUS 40924_40707 6504 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector PSM2, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6504) AUTHORS Rahnama M, Forester N, Ariyawansa S, Voisey CR, Johnson LJ, Johnson RD, Fleetwood DJ. TITLE Efficient targeted mutagenesis in Epichloe festucae using a split marker system JOURNAL Unpublished REFERENCE 2 (bases 1 to 6504) AUTHORS Rahnama M, Fleetwood D. TITLE Direct Submission JOURNAL Submitted (27-SEP-2016) School of Biological Sciences, University of Auckland, 3A Symonds Street, Auckland, Auckland 1010, New Zealand REFERENCE 3 (bases 1 to 6504) TITLE Direct Submission REFERENCE 4 (bases 1 to 6504) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (27-SEP-2016) School of Biological Sciences, University of Auckland, 3A Symonds Street, Auckland, Auckland 1010, New Zealand" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..6504 /mol_type="other DNA" /organism="synthetic DNA construct" terminator complement(268..295) /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" terminator complement(387..473) /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" CDS 513..1454 /codon_start=1 /gene="hph" /product="hygromycin B phosphotransferase" /label=hph /protein_id="APD72153.1" /translation="SEGEESRAFSFDVGGRGYVLRVNSCADGFYKDRYVYRHFASAALP IPEVLDIGEFSESLTYCISRRAQGVTLQDLPETELPAVLQPVAEAMDAIAAADLSQTSG FGPFGPQGIGQYTTWRDFICAIADPHVYHWQTVMDDTVSASVAQALDELMLWAEDCPEV RHLVHADFGSNNVLTDNGRITAVIDWSEAMFGDSQYEVANIFFWRPWLACMEQQTRYFE RRHPELAGSPRLRAYMLRIGLDQLYQSLVDGNFDDAAWAQGRCDAIVRSGAGTVGRTQI ARRSAAVWTDGCVEVLADSGNRRPSTRPRAKE" gene 513..1454 /gene="hph" /label=hph terminator 1472..2240 /label=trpC terminator /note="transcription terminator from the Aspergillus nidulans trpC gene (Punt et al., 1987)" primer_bind 2279..2295 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" protein_bind 2312..2543 /label=attP1 /note="recombination site for the Gateway(R) BP reaction (pDONR(TM)221 version)" CDS complement(2942..3244) /codon_start=1 /label=ccdB /note="CcdB, a bacterial toxin that poisons DNA gyrase" /translation="MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDK VSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEVADLSHRENDIKNAINLMFWGI" CDS complement(3592..4248) /codon_start=1 /label=CmR /note="chloramphenicol acetyltransferase" /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA" promoter complement(4249..4351) /label=cat promoter /note="promoter of the E. coli cat gene encoding chloramphenicol acetyltransferase" protein_bind complement(4496..4727) /label=attP2 /note="recombination site for the Gateway(R) BP reaction (pDONR(TM)221 version)" promoter complement(4746..4764) /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" primer_bind complement(4769..4785) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" CDS 4898..5704 /codon_start=1 /label=KanR /note="aminoglycoside phosphotransferase" /translation="MSHIQRETSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYGKP DAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGKTA FQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDASD FDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGIAD RYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF" rep_origin 5854..6442 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.