Basic Vector Information
- Vector Name:
- pSM03
- Antibiotic Resistance:
- Ampicillin
- Length:
- 8732 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Lo J, Olson DG, Murphy SJ, Tian L, Hon S, Lanahan A, Guss AM, Lynd LR.
pSM03 vector Map
pSM03 vector Sequence
LOCUS V003140 8732 bp DNA circular SYN 18-DEC-2018 DEFINITION Exported. ACCESSION V003140 VERSION V003140 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 8732) AUTHORS Lo J, Olson DG, Murphy SJ, Tian L, Hon S, Lanahan A, Guss AM, Lynd LR. TITLE Engineering electron metabolism to increase ethanol production in Clostridium thermocellum JOURNAL Metab. Eng. (2016) In press PUBMED 27989806 REFERENCE 2 (bases 1 to 8732) AUTHORS Lo J, Olson DG, Murphy SJ, Tian L, Hon S, Lanahan A, Guss AM, Lynd LR. TITLE Direct Submission JOURNAL Submitted (05-DEC-2016) Thayer School of Engineering, Dartmouth College, 14 Engineering Drive, Hanover, NH 03755, USA REFERENCE 3 (bases 1 to 8732) TITLE Direct Submission REFERENCE 4 (bases 1 to 8732) AUTHORS . TITLE Direct Submission COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## SGRef: number: 1; type: "Journal Article"; journalName: "Metab. Eng. (2016) In press" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (05-DEC-2016) Thayer School of Engineering, Dartmouth College, 14 Engineering Drive, Hanover, NH 03755, USA" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..8732 /mol_type="other DNA" /organism="synthetic DNA construct" terminator 33..221 /label="CYC1 terminator" /note="transcription terminator for CYC1" rep_origin complement(481..1069) /direction=LEFT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(1156..1734) /codon_start=1 /product="Tdk" /EC_number="2.7.1.21" /label="Tdk" /note="thymidine kinase" /protein_id="APQ46124.1" /translation="MYGPKDHGYIEVVTGPMFSGKSEELIRRIKRAKIARQKVQVFKPA IDDRYSIDKVVSHNGDNMHAIAIVKASDILAYAEEDTDVFAIDEVQFFDSEIVDIVKEI ADSGKRVICAGLDMDFRGEPFGPTPELMAIAEFVDKLTAICMKCGNPATRTQRLINGKP ANYDDPIIMVGAKESYEARCRKCHEVPRT" CDS complement(2434..3435) /label="repB" /note="RepB replication protein" CDS complement(3996..4853) /label="AmpR" /note="beta-lactamase" promoter complement(4854..4958) /label="AmpR promoter" CDS 6126..6773 /gene="cat" /label="Chloramphenicol acetyltransferase" /note="Chloramphenicol acetyltransferase from Staphylococcus aureus. Accession#: P00485" CDS 6794..7339 /codon_start=1 /product="Hpt" /EC_number="2.4.2.8" /label="Hpt" /note="hypoxanthine phosphoribosyltransferase" /protein_id="APQ46123.1" /translation="MENLSKDIDEILITEEELKEKIKELGRQITKDYKGKNLMLVGVLK GALMFMADLSRHIDLPLSLDFMAVSSYGSSTHSSGIVKIIKDLDISIEGKDVLIVEDII DSGLTLSYLRETLLGRKPKSLKICTILDKPERREASVKVDYVGFKIPDKFVVGYGLDFD EKYRNLPFIGVLKPEMYS"
This page is informational only.