pSLI-PfEHD2xFKBP vector (V003148)

Download GeneBank File(.gb)

LOCUS       V003148                 8609 bp    DNA     circular SYN 18-DEC-2018
DEFINITION  Exported.
ACCESSION   V003148
VERSION     V003148
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
            .
REFERENCE   1  (bases 1 to 8609)
  AUTHORS   Mesen-Ramirez P, Reinsch F, Blancke Soares A, Bergmann B, Ullrich
            AK, Tenzer S, Spielmann T.
  TITLE     Stable Translocation Intermediates Jam Global Protein Export in
            Plasmodium falciparum Parasites and Link the PTEX Component EXP2
            with Translocation Activity
  JOURNAL   PLoS Pathog. 12 (5), E1005618 (2016)
   PUBMED   27168322
REFERENCE   2  (bases 1 to 8609)
  AUTHORS   Birnbaum J, Flemming S, Spielmann T.
  TITLE     Direct Submission
  JOURNAL   Submitted (29-MAR-2016) Parasitology Section, Bernhard Nocht
            Institute for Tropical Medicine, Bernhard-Nocht-Str. 74, Hamburg
            20359, Germany
REFERENCE   3  (bases 1 to 8609)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 8609)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "PLoS
            Pathog."; date: "2016"; volume: "12"; issue: "5"; pages: "E1005618"
            SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
            (29-MAR-2016) Parasitology Section, Bernhard Nocht Institute for
            Tropical Medicine, Bernhard-Nocht-Str. 74, Hamburg 20359, Germany"
            SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..8609
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     regulatory      1..453
                     /label="P. berghei 3' region"
                     /note="P. berghei 3' region"
                     /regulatory_class="terminator"
     regulatory      complement(465..810)
                     /label="Pfhop 5' region"
                     /note="Pfhop 5' region"
                     /regulatory_class="terminator"
     regulatory      811..1301
                     /label="PfCAM 5' region"
                     /note="PfCAM 5' region"
                     /regulatory_class="promoter"
     CDS             1308..1868
                     /gene="DHFR"
                     /label="Dihydrofolate reductase"
                     /note="Dihydrofolate reductase from Homo sapiens.
                     Accession#: P00374"
     regulatory      1874..2443
                     /label="P. falciparum hrpII 3' region"
                     /note="P. falciparum hrpII 3' region"
                     /regulatory_class="terminator"
     promoter        complement(2448..2465)
                     /label="T7 promoter"
                     /note="promoter for bacteriophage T7 RNA polymerase"
     primer_bind     complement(2472..2488)
                     /label="M13 fwd"
                     /note="common sequencing primer, one of multiple similar
                     variants"
     promoter        2962..3066
                     /label="AmpR promoter"
     CDS             3067..3924
                     /label="AmpR"
                     /note="beta-lactamase"
     rep_origin      4098..4686
                     /label="ori"
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
                     replication"
     protein_bind    4974..4995
                     /label="CAP binding site"
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     promoter        5010..5040
                     /label="lac promoter"
                     /note="promoter for the E. coli lac operon"
     protein_bind    5048..5064
                     /label="lac operator"
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be
                     relieved by adding lactose or
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     primer_bind     5072..5088
                     /label="M13 rev"
                     /note="common sequencing primer, one of multiple similar
                     variants"
     promoter        5106..5124
                     /label="SP6 promoter"
                     /note="promoter for bacteriophage SP6 RNA polymerase"
     misc_feature    5142..6257
                     /note="similar to PfEHD; P. falciparum Eps 15 homology
                     domain protein, C-terminal fragment (162-533)"
     misc_feature    6264..6320
                     /label="linker"
                     /note="linker"
     misc_feature    6327..6980
                     /note="similar to 2xFKBP; 2 x FKBP (FK506 binding protein)"
     CDS             6330..6650
                     /codon_start=1
                     /product="human FK506-binding protein FKBP12"
                     /label="FKBP"
                     /translation="GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKP
                     FKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELL
                     KLE"
     CDS             6657..6977
                     /codon_start=1
                     /product="human FK506-binding protein FKBP12"
                     /label="FKBP"
                     /translation="GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKP
                     FKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELL
                     KLE"
     misc_feature    6987..7025
                     /label="linker"
                     /note="linker"
     CDS             7032..7745
                     /label="yeGFP"
                     /note="yeast-enhanced green fluorescent protein"
     misc_feature    7752..7808
                     /label="T2A sequence"
                     /note="T2A sequence"
     CDS             7755..7808
                     /codon_start=1
                     /product="2A peptide from Thosea asigna virus capsid
                     protein"
                     /label="T2A"
                     /note="Eukaryotic ribosomes fail to insert a peptide bond
                     between the Gly and Pro residues, yielding separate
                     polypeptides."
                     /translation="EGRGSLLTCGDVEENPGP"
     CDS             7809..8600
                     /label="NeoR/KanR"
                     /note="aminoglycoside phosphotransferase"