Basic Vector Information
- Vector Name:
- pSK5640
- Antibiotic Resistance:
- Ampicillin
- Length:
- 6152 bp
- Type:
- Shuttle vector
- Replication origin:
- ori
- Source/Author:
- Grkovic S, Brown MH, Hardie KM, Firth N, Skurray RA.
pSK5640 vector Map
pSK5640 vector Sequence
LOCUS V003157 6152 bp DNA circular SYN 18-DEC-2018 DEFINITION Exported. ACCESSION V003157 VERSION V003157 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 6152) AUTHORS Grkovic S, Brown MH, Hardie KM, Firth N, Skurray RA. TITLE Stable low-copy-number Staphylococcus aureus shuttle vectors JOURNAL Microbiology (Reading, Engl.) 149 (PT 3), 785-794 (2003) PUBMED 12634346 REFERENCE 2 (bases 1 to 6152) AUTHORS Grkovic S, Brown MH, Hardie KM, Firth N, Skurray RA. TITLE Direct Submission JOURNAL Submitted (20-NOV-2002) Biological Sciences, University of Sydney, Macleay Building, A12, Sydney, NSW 2006, Australia REFERENCE 3 (bases 1 to 6152) TITLE Direct Submission REFERENCE 4 (bases 1 to 6152) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Microbiology (Reading, Engl.) 149 (PT 3), 785-794 (2003)" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (20-NOV-2002) Biological Sciences, University of Sydney, Macleay Building, A12, Sydney, NSW 2006, Australia" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..6152 /mol_type="other DNA" /organism="synthetic DNA construct" misc_feature complement(1..57) /label="MCS" /note="pUC18/19 multiple cloning site" primer_bind complement(58..74) /label="M13 fwd" /note="common sequencing primer, one of multiple similar variants" CDS 700..1347 /gene="cat" /label="Chloramphenicol acetyltransferase" /note="Chloramphenicol acetyltransferase from Staphylococcus aureus. Accession#: P00485" CDS complement(1605..2342) /codon_start=1 /gene="par" /product="partitioning protein" /label="par" /note="Par" /protein_id="AAO24790.1" /translation="MKTIKMVADELNVTKQTVVNNAKNLNISFEKENGVNYIDDNDYLK IVEKITKKERTTQNKENKKSEITYENTEKNRYNNSDGFETLKTKVNELEKQVEIFETRA KNDEKYIENLTKQLDQQNSNVNTLNKLLENQQILALESNKKIQKLEHQLEEERQLSYSF DKSTNDRENFDVQEASYTSDSVNTDQYQKEEKKPEVQPKDISESQQDEKSQQQDDSFNQ NDKDIAIEETQTKKGFWSRLFGG" gene complement(1605..2342) /gene="par" /label="par" CDS 2767..3687 /codon_start=1 /gene="rep" /product="replication protein" /label="rep" /note="Rep" /protein_id="AAO24791.1" /translation="MSKFKKISASEFETLRFYQLPKFLFEDEYFSKMPTDAKVMYALLK DRFELSRLNNWVDSENNIYLLYTNKQLCSILNYAEPKIIKLKKELEKYNLIINERQGLN KPNKIYLLEPTYDKELINSKFQNKEFISSRTNKSSVQELINSKSSDTDFNNTEYIETKN NDTNYTNDTSNMISKNSHSNHTNHQQTEFNNDALKFQALEELPSQIKSYVSNFEIKDIR IIKSILLKGKKSFNNTHDTYYRLEDVEFELVSVLKRFKAMLLQKNETVETMQGYLMQSI KAELEEIHALNMRRQNIPQYNIFNQ" gene 2767..3687 /gene="rep" /label="rep" promoter 3783..3887 /label="AmpR promoter" CDS 3888..4745 /label="AmpR" /note="beta-lactamase" rep_origin 4919..5507 /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" misc_feature complement(5693..5833) /label="bom" /note="basis of mobility region from pBR322" protein_bind 6026..6047 /label="CAP binding site" /note="CAP binding activates transcription in the presence of cAMP." promoter 6062..6092 /label="lac promoter" /note="promoter for the E. coli lac operon" protein_bind 6100..6116 /label="lac operator" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." primer_bind 6124..6140 /label="M13 rev" /note="common sequencing primer, one of multiple similar variants"
This page is informational only.