Basic Vector Information
- Vector Name:
- pOSCAR
- Antibiotic Resistance:
- Streptomycin
- Length:
- 9422 bp
- Type:
- Binary vector
- Replication origin:
- ori
- Source/Author:
- Paz Z, Garcia-Pedrajas MD, Andrews DL, Klosterman SJ, Baeza-Montanez L, Gold SE.
pOSCAR vector Map
pOSCAR vector Sequence
LOCUS 40924_33877 9422 bp DNA circular SYN 18-DEC-2018 DEFINITION Binary vector pOSCAR, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 9422) AUTHORS Paz Z, Garcia-Pedrajas MD, Andrews DL, Klosterman SJ, Baeza-Montanez L, Gold SE. TITLE One Step Construction of Agrobacterium-Recombination-ready-plasmids (OSCAR), an efficient and robust tool for ATMT based gene deletion construction in fungi JOURNAL Fungal Genet. Biol. 48 (7), 677-684 (2011) PUBMED 21362493 REFERENCE 2 (bases 1 to 9422) AUTHORS Paz Z, Garcia-Pedrajas MD, Andrews DL, Klosterman SJ, Baeza-Montanez L, Gold SE. TITLE Direct Submission JOURNAL Submitted (01-JUL-2010) Plant Pathology, The University of Georgia, 2105 Miller Plant Sci Bldg, Athens, GA 30602-7274, USA REFERENCE 3 (bases 1 to 9422) TITLE Direct Submission REFERENCE 4 (bases 1 to 9422) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Fungal Genet. Biol."; date: "2011"; volume: "48"; issue: "7"; pages: "677-684" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (01-JUL-2010) Plant Pathology, The University of Georgia, 2105 Miller Plant Sci Bldg, Athens, GA 30602-7274, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..9422 /mol_type="other DNA" /organism="synthetic DNA construct" misc_feature complement(1742..1766) /label=RB T-DNA repeat /note="right border repeat from nopaline C58 T-DNA" primer_bind 1829..1845 /label=M13 rev /note="common sequencing primer, one of multiple similar variants" promoter 1850..1868 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" protein_bind 1906..2137 /label=attP3 /note="recombination site for the Gateway(R) BP reaction" CDS complement(2497..2799) /codon_start=1 /label=ccdB /note="CcdB, a bacterial toxin that poisons DNA gyrase" /translation="MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDK VSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEVADLSHRENDIKNAINLMFWGI" CDS complement(3144..3800) /codon_start=1 /label=CmR /note="chloramphenicol acetyltransferase" /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA" promoter complement(3801..3903) /label=cat promoter /note="promoter of the E. coli cat gene encoding chloramphenicol acetyltransferase" protein_bind 4061..4292 /label=attP2 /note="recombination site for the Gateway(R) BP reaction" primer_bind complement(4330..4346) /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" misc_feature complement(4629..4653) /label=LB T-DNA repeat /note="left border repeat from nopaline C58 T-DNA" CDS 5181..5969 /codon_start=1 /label=SmR /note="aminoglycoside adenylyltransferase (Murphy, 1985)" /translation="MGEAVIAEVSTQLSEVVGVIERHLEPTLLAVHLYGSAVDGGLKPH SDIDLLVTVTVRLDETTRRALINDLLETSASPGESEILRAVEVTIVVHDDIIPWRYPAK RELQFGEWQRNDILAGIFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQDLF EALNETLTLWNSPPDWAGDERNVVLTLSRIWYSAVTGKIAPKDVAADWAMERLPAQYQP VILEARQAYLGQEEDRLASRADQLEEFVHYVKGEITKVVGK" rep_origin 6216..6804 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" misc_feature complement(6990..7130) /label=bom /note="basis of mobility region from pBR322" rep_origin complement(7474..7668) /direction=LEFT /label=pVS1 oriV /note="origin of replication for the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" CDS complement(7737..8801) /codon_start=1 /label=pVS1 RepA /note="replication protein from the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" /translation="GRKPSGPVQIGAALGDDLVEKLKAAQAAQRQRIEAEARPGESWQA AADRIRKESRQPPAAGAPSIRKPPKGDEQPDFFVPMLYDVGTRDSRSIMDVAVFRLSKR DRRAGEVIRYELPDGHVEVSAGPAGMASVWDYDLVLMAVSHLTESMNRYREGKGDKPGR VFRPHVADVLKFCRRADGGKQKDDLVETCIRLNTTHVAMQRTKKAKNGRLVTVSEGEAL ISRYKIVKSETGRPEYIEIELADWMYREITEGKNPDVLTVHPDYFLIDPGIGRFLYRLA RRAAGKAEARWLFKTIYERSGSAGEFKKFCFTVRKLIGSNDLPEYDLKEEAGQAGPILV MRYRNLIEGEASAGS" CDS complement(join(9238..9422,1..442)) /codon_start=1 /label=pVS1 StaA /note="stability protein from the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" /translation="MKVIAVLNQKGGSGKTTIATHLARALQLAGADVLLVDSDPQGSAR DWAAVREDQPLTVVGIDRPTIDRDVKAIGRRDFVVIDGAPQAADLAVSAIKAADFVLIP VQPSPYDIWATADLVELVKQRIEVTDGRLQAAFVVSRAIKGTRNGGEVAEALAGYELPI LESRITQRVSYPGTAAAGTTVLESEPEGDAAREVQALAAEIKSKLI"
This page is informational only.