Basic Vector Information
- Vector Name:
- pOKvtpKO
- Antibiotic Resistance:
- Kanamycin
- Length:
- 7541 bp
- Type:
- Inactivation vector
- Replication origin:
- p15A ori
- Source/Author:
- Battisti JM, Raffel SJ, Schwan TG.
pOKvtpKO vector Vector Map
pOKvtpKO vector Sequence
LOCUS 40924_33752 7541 bp DNA circular SYN 18-DEC-2018 DEFINITION Inactivation vector pOKvtpKO, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 7541) AUTHORS Battisti JM, Raffel SJ, Schwan TG. TITLE A System for Site-Specific Genetic Manipulation of the Relapsing Fever Spirochete Borrelia hermsii JOURNAL Unpublished REFERENCE 2 (bases 1 to 7541) AUTHORS Battisti JM, Raffel SJ, Schwan TG. TITLE Direct Submission JOURNAL Submitted (09-MAR-2007) Laboratory of Zoonotic Pathogens, Rocky Mountain Laboratories, National Institute of Allergy and Infectious Diseases, National Institutes of Health, 903 S. 4th Street, Hamilton, MT 59840, USA REFERENCE 3 (bases 1 to 7541) TITLE Direct Submission REFERENCE 4 (bases 1 to 7541) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (09-MAR-2007) Laboratory of Zoonotic Pathogens, Rocky Mountain Laboratories, National Institute of Allergy and Infectious Diseases, National Institutes of Health, 903 S. 4th Street, Hamilton, MT 59840, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..7541 /mol_type="other DNA" /organism="synthetic DNA construct" rep_origin complement(51..595) /direction=LEFT /label=p15A ori /note="Plasmids containing the medium-copy-number p15A origin of replication can be propagated in E. coli cells that contain a second plasmid with the ColE1 origin." CDS 805..1611 /label=KanR /note="aminoglycoside phosphotransferase" misc_feature complement(1727..2512) /note="similar to thymidylate synthase; 3' end of gene is not cloned into the vector" gene 1727..2512 /gene="thyX" /label=thyX /note="orfZ" CDS complement(2796..3686) /codon_start=1 /product="hypothetical protein" /label=hypothetical protein /note="orfY" /protein_id="ABS71244.1" /translation="MKKSILTVCMFILLCLLSCDIDALNDLLSKAREKFLEENKNIEGS DHKQEGKEEQVDVVKNMEEGVRQVVQGDPVAPVDDAIPAFQYPQQETIEIEEKDLIPST KEEKEAQEEIEKVKSVLEDSKFDQLIENSRKLQSESKQLESDFYRIFSELQTKLQEQRS LPKINSQTDRAKIQELIKLQNRFNEKRTQIDMLMTQVDAGFNERSSAKYFFEEAEKTLK EAITERLKNALRSSFRRVANYLSGQLSREARRYAENSLSLLESSSGKIGEAMGIRKDIE ELIKEAKSYLSSLVR" regulatory 4175..4295 /label=flgB promoter derived from Borrelia hermsii /note="flgB promoter derived from Borrelia hermsii" /regulatory_class="promoter" CDS 4296..5102 /label=KanR /note="aminoglycoside phosphotransferase" CDS 6073..6603 /codon_start=1 /product="hypothetical protein" /label=hypothetical protein /note="orfX" /protein_id="ABS71246.1" /translation="MSFSFKNFKLTKMLFIFLLAACSSLQVEHDKINNKVRIYQYLNEN FELKGVVDHQNNTTQIFLYTKIRNHSIVKQTPLILPDGTKIEGKTSYEYDSKASLGKWV NASSFSLNKAILKKILNEDEHVYNKEDIKVQVGLETLKINKAKIIEFLSKLNAIEKQHT QKQHPDKQNTHKQ"
This page is informational only.