Basic Vector Information
- Vector Name:
- pOK12-vtp-gentR
- Antibiotic Resistance:
- Kanamycin
- Length:
- 7530 bp
- Type:
- Suicide vector
- Replication origin:
- p15A ori
- Source/Author:
- Battisti JM, Raffel SJ, Schwan TG.
pOK12-vtp-gentR vector Map
pOK12-vtp-gentR vector Sequence
LOCUS 40924_33742 7530 bp DNA circular SYN 18-DEC-2018 DEFINITION Suicide vector pOK12-vtp-gentR, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 7530) AUTHORS Battisti JM, Raffel SJ, Schwan TG. TITLE A System for Site-Specific Genetic Manipulation of the Relapsing Fever Spirochete Borrelia hermsii JOURNAL Unpublished REFERENCE 2 (bases 1 to 7530) AUTHORS Battisti JM, Raffel SJ, Schwan TG. TITLE Direct Submission JOURNAL Submitted (09-MAR-2007) Laboratory of Zoonotic Pathogens, Rocky Mountain Laboratories, National Institute of Allergy and Infectious Diseases, National Institutes of Health, 903 S. 4th Street, Hamilton, MT 59840, USA REFERENCE 3 (bases 1 to 7530) TITLE Direct Submission REFERENCE 4 (bases 1 to 7530) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (09-MAR-2007) Laboratory of Zoonotic Pathogens, Rocky Mountain Laboratories, National Institute of Allergy and Infectious Diseases, National Institutes of Health, 903 S. 4th Street, Hamilton, MT 59840, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..7530 /mol_type="other DNA" /organism="synthetic DNA construct" rep_origin complement(51..595) /direction=LEFT /label=p15A ori /note="Plasmids containing the medium-copy-number p15A origin of replication can be propagated in E. coli cells that contain a second plasmid with the ColE1 origin." CDS 805..1611 /label=KanR /note="aminoglycoside phosphotransferase" misc_feature complement(1727..2512) /gene="thyX" /note="similar to thymidylate synthase; orfZ; 3' end of gene is not cloned into the vector" gene complement(1727..2512) /gene="thyX" /label=thyX CDS complement(2796..3686) /codon_start=1 /product="hypothetical protein" /label=hypothetical protein /note="orfY" /protein_id="ABS71239.1" /translation="MKKSILTVCMFILLCLLSCDIDALNDLLSKAREKFLEENKNIEGS DHKQEGKEEQVDVVKNMEEGVRQVVQGDPVAPVDDAIPAFQYPQQETIEIEEKDLIPST KEEKEAQEEIEKVKSVLEDSKFDQLIENSRKLQSESKQLESDFYRIFSELQTKLQEQRS LPKINSQTDRAKIQELIKLQNRFNEKRTQIDMLMTQVDAGFNERSSAKYFFEEAEKTLK EAITERLKNALRSSFRRVANYLSGQLSREARRYAENSLSLLESSSGKIGEAMGIRKDIE ELIKEAKSYLSSLVR" CDS complement(4061..4690) /codon_start=1 /gene="vtp" /product="variable tick protein" /label=vtp /note="derived from Borrelia hermsii" /protein_id="ABS71240.1" /translation="MKKNTLSAILMTLFLFISCNNGGPELKKGEVTKSDGTVLDLSKIS ANIKNAVTFAASVQEVETLVKSIDELAKAIGQKVNADGLTAEADKNDSLVAGVYQLISD VQGKLTKLEIGASKFAGLKEKVVAAKKGSDDFLTKVKAQHNNLGQSAEAPKAIKKGNAD STKGAEELGKLNTAIDELLTAAKDAVEAAIAELTAAPAKPATPVKP" gene complement(4061..4690) /gene="vtp" /label=vtp regulatory 4984..5269 /label=flaB promoter derived from Borrelia hermsii /note="flaB promoter derived from Borrelia hermsii" /regulatory_class="promoter" CDS 5270..5800 /label=GmR /note="gentamycin acetyltransferase" CDS 6063..6593 /codon_start=1 /product="hypothetical protein" /label=hypothetical protein /note="orfX" /protein_id="ABS71242.1" /translation="MSFSFKNFKLTKMLFIFLLAACSSLQVEHDKINNKVRIYQYLNEN FELKGVVDHQNNTTQIFLYTKIRNHSIVKQTPLILPDGTKIEGKTSYEYDSKASLGKWV NASSFNLNKAILKKILNEDEHVYNKEDIKVQVGLETLKINKAKIIEFLSKLNAIEKQHT QKQHPDKQNTHKQ"
This page is informational only.