Basic Vector Information
- Vector Name:
- pNZ4
- Antibiotic Resistance:
- Ampicillin
- Length:
- 9809 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Zhang N, Magee BB, Magee PT, Cannon R, Schmid J.
pNZ4 vector Map
pNZ4 vector Sequence
LOCUS 40924_33697 9809 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pNZ4, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 9809) AUTHORS Zhang N, Magee BB, Magee PT, Cannon R, Schmid J. TITLE A method for mating clinical Candida albicans isolates JOURNAL Unpublished REFERENCE 2 (bases 1 to 9809) AUTHORS Zhang N, Magee BB, Magee PT, Cannon R, Schmid J. TITLE Direct Submission JOURNAL Submitted (04-MAR-2009) IMBS, Massey University, Riddet Road, Palmerston North 4410, New Zealand REFERENCE 3 (bases 1 to 9809) TITLE Direct Submission REFERENCE 4 (bases 1 to 9809) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (04-MAR-2009) IMBS, Massey University, Riddet Road, Palmerston North 4410, New Zealand" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..9809 /mol_type="other DNA" /organism="synthetic DNA construct" rep_origin complement(3..458) /direction=LEFT /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" primer_bind 600..616 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" promoter 626..644 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" mobile_element 683..1491 /mobile_element_type="insertion sequence:TS1" /label=insertion sequence:TS1 /note="from Candida albicans chromosome 7" terminator 1644..1831 /label=ADH1 terminator /note="transcription terminator for the S. cerevisiae alcohol dehydrogenase 1 (ADH1) gene" promoter 1852..1907 /label=tetR/tetA promoters /note="overlapping promoters for bacterial tetR and tetA" misc_feature 2083..4189 /label=IMH3r ORF plus terminator from plasmid p3408 /note="IMH3r ORF plus terminator from plasmid p3408" CDS join(2083..2533,2781..3895) /codon_start=1 /product="IMH3r" /label=IMH3r /protein_id="ACY78684.1" /translation="MVFETSKATSYLKDYPKKDGLSVKELIDSTNFGGLTYNDFLILPG LVNFPSSAVSLETKLTKKITLKSPFVSSPMDTVTEENMAIHMALLGGIGIIHHNCTAEE QAEMVRKVKKYENGFINDPVVISPEVTVGEVKKMGEVLGFTSFPVTENGKVGGKLVGII TSRDIQFHEDNKSPVSEVMTKDLVVGKKGISLTDGNELLRSSKKGKLPIVDAEGNLVSL ISRTDLQKNQDYPNASKSFHSKQLLCGAAIGTIDADRERLDKLVEAGLDVVVLDSSNGS SVFQLNMIKWIKEKYPELQVIAGNVVTREQAALLIEAGADALRIGMGSGSICITQEVMA CGRPQGTAVYGVTEFANKFGVPCIADGGIGNIGHITKALALGASCVMMGGLLAGTAETP DDYFYRDGKRLKTYRGMGSIDAMQQTNTNANASTSRYFSEADKVLVAQGVSGSVVDKGS ITKFVPYLYNGLQHSLQDIGIKSIDELRENVDNGEIRFEFRTASAQFEGGVHGLHSYEK RLHN" CDS complement(4462..4542) /label=3xHA /note="three tandem HA epitope tags" CDS complement(5239..5859) /label=TetR /note="tetracycline repressor TetR" regulatory 5860..6387 /label=PENO1 from plasmid pCAITHE5 /note="PENO1 from plasmid pCAITHE5" /regulatory_class="promoter" mobile_element 6404..7560 /mobile_element_type="insertion sequence:TS2" /label=insertion sequence:TS2 /note="from Candida albicans chromosome 7" primer_bind complement(7575..7591) /label=KS primer /note="common sequencing primer, one of multiple similar variants" promoter complement(7621..7639) /label=T3 promoter /note="promoter for bacteriophage T3 RNA polymerase" primer_bind complement(7660..7676) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(7684..7700) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(7708..7738) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(7753..7774) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(8062..8650) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(8824..9681) /label=AmpR /note="beta-lactamase" promoter complement(9682..9786) /label=AmpR promoter
This page is informational only.