Basic Vector Information
- Vector Name:
- pNR-46121
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5544 bp
- Type:
- Shuttle vector
- Replication origin:
- ori
- Source/Author:
- Charpentier E, Anton AI, Barry P, Alfonso B, Fang Y, Novick RP.
pNR-46121 vector Vector Map
pNR-46121 vector Sequence
LOCUS 40924_33477 5544 bp DNA circular SYN 18-DEC-2018 DEFINITION Shuttle vector pNR-46121, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5544) AUTHORS Charpentier E, Anton AI, Barry P, Alfonso B, Fang Y, Novick RP. TITLE Novel cassette-based shuttle vector system for gram-positive bacteria JOURNAL Appl. Environ. Microbiol. 70 (10), 6076-6085 (2004) PUBMED 15466553 REFERENCE 2 (bases 1 to 5544) AUTHORS Riojas MA, Bojja K, Hazbon MH. TITLE pNR-46121, A Shuttle Vector for Gram-Positive Bacteria JOURNAL Unpublished REFERENCE 3 (bases 1 to 5544) AUTHORS Riojas MA, Bojja K, Hazbon MH. TITLE Direct Submission JOURNAL Submitted (17-JUN-2014) Bacteriology, BEI Resources/American Type Culture Collection (ATCC), 10801 University Blvd., Manassas, VA 20110, USA REFERENCE 4 (bases 1 to 5544) TITLE Direct Submission REFERENCE 5 (bases 1 to 5544) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Appl. Environ. Microbiol."; date: "2004"; volume: "70"; issue: "10"; pages: "6076-6085" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 3; type: "Journal Article"; journalName: "Submitted (17-JUN-2014) Bacteriology, BEI Resources/American Type Culture Collection (ATCC), 10801 University Blvd., Manassas, VA 20110, USA" COMMENT SGRef: number: 4; type: "Journal Article" COMMENT ##Assembly-Data-START## Assembly Method :: CLC Genomics Workbench v. 7.0.2 Sequencing Technology :: Illumina ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..5544 /mol_type="other DNA" /organism="synthetic DNA construct" misc_feature 1..1417 /note="pT181 cop-wt repC; derived from J01764.1 Staphylococcus aureus plasmid pT181" CDS 157..960 /codon_start=1 /gene="repC" /product="replication initiation protein" /label=repC /protein_id="AIL56502.1" /translation="MTIVGNLNRDNAQALSKFMSVEPQIRLWDILQTKFKAKALQEKVY IEYDKVKADSWDRRNMRIEFNPNKLTRDEMIWLKQNIISYMEDDGFTRLDLAFDFEDDL SDYYAMSDKAVKKTIFYGRNGKPETKYFGVRDSNRFIRIYNKKQERKDNADAEVMSEHL WRVEIELKRDMVDYWNDCFSDLHILQPDWKTIQRTADRAIVFMLLSDEEEWGKLHRNSR TKYKNLIKEISPVDLTDLMKSTLKANEKQLQKQIDFWQHEFKFWK" gene 157..960 /gene="repC" /label=repC misc_feature 1122..1417 /gene="tetK" /label=truncated tetracycline efflux protein /note="truncated tetracycline efflux protein" gene 1122..1417 /gene="tetK" /label=tetK CDS 1611..2402 /label=KanR /note="aminoglycoside phosphotransferase" promoter 2808..2912 /label=AmpR promoter CDS 2913..3770 /label=AmpR /note="beta-lactamase" rep_origin 3944..4532 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" primer_bind complement(4714..4730) /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" misc_feature 4873..5544 /note="pT181 cop-wt repC; derived from J01764.1 Staphylococcus aureus plasmid pT181"
This page is informational only.