Price Information
Cat No. | Plasmid Name | Availability | Add to cart |
---|---|---|---|
V011751 | pET21-10XHis-GST-HRV-dL5 | In stock, 1 week for quality controls |
Buy one, get one free! |
Two tubes of lyophilized plasmid will be delivered, each tube is about 5µg.
Basic Vector Information
- Vector Name:
- pET21-10XHis-GST-HRV-dL5
- Antibiotic Resistance:
- Ampicillin
- Length:
- 6868 bp
- Type:
- Bacterial Expression
- Replication origin:
- ori
- Copy Number:
- Low Copy
- Promoter:
- T7
- Cloning Method:
- Restriction Enzyme
- 5' Primer:
- T7 and GSTSeqF
- 3' Primer:
- T7term
pET21-10XHis-GST-HRV-dL5 vector Map
Plasmid Protocol
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5. Store the plasmid at -20 ℃.
6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it
General Plasmid Transform Protocol
1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.
2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.
3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.
4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.
5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.
pET21-10XHis-GST-HRV-dL5 vector Sequence
LOCUS 40924_18341 6868 bp DNA circular SYN 13-MAY-2021 DEFINITION Bacterial expression vector for dL5(E52D) protein with N-terminal His10, GST and HRV3C cleavage site (MBIC5, dL5**, FAP). ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6868) AUTHORS Wang Y, Telmer CA, Schmidt BF, Franke JD, Ort S, Arndt-Jovin DJ, Bruchez MP TITLE Fluorogen activating protein-affibody probes: modular, no-wash measurement of epidermal growth factor receptors. JOURNAL Bioconjug Chem. 2015 Jan 21;26(1):137-44. doi: 10.1021/bc500525b. Epub 2014 Dec 19. PUBMED 25490520 REFERENCE 2 (bases 1 to 6868) TITLE Direct Submission REFERENCE 3 (bases 1 to 6868) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; doi: "10.1021/bc500525b"; journalName: "Bioconjug Chem"; date: "2015-01-21- 21"; volume: "26"; issue: "1"; pages: "137-44" COMMENT SGRef: number: 2; type: "Journal Article" FEATURES Location/Qualifiers source 1..6868 /mol_type="other DNA" /organism="synthetic DNA construct" rep_origin 12..467 /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" promoter 494..598 /label=AmpR promoter CDS 599..1456 /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="[TEM beta-lactamase fragment, 45 aa] ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS [TEM beta-lactamase fragment, 59 aa] EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA [TEM beta-lactamase fragment, 59 aa] LIKHW" rep_origin 1630..2218 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" primer_bind 2372..2389 /label=L4440 /note="L4440 vector, forward primer" misc_feature complement(2404..2546) /label=bom /note="basis of mobility region from pBR322" primer_bind 2632..2654 /label=pGEX 3' /note="pGEX vectors, reverse primer" CDS complement(2651..2839) /codon_start=1 /label=rop /note="Rop protein, which maintains plasmids at low copy number" /translation="VTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHA DELYRSCLARFGDDGENL" protein_bind complement(3614..3635) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." CDS complement(3651..4730) /codon_start=1 /label=lacI /note="lac repressor" /translation="VKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAEL NYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGV EACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSIIFSH EDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSA MSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSC YIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPNTQTASPR ALADSLMQLARQVSRLESGQ" promoter complement(4731..4808) /label=lacI promoter primer_bind 5014..5033 /label=pBRrevBam /note="pBR322 vectors, tet region, downstream of BamHI, reverse primer" promoter 5117..5135 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" protein_bind 5136..5160 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." RBS 5175..5197 /label=RBS /note="efficient ribosome binding site from bacteriophage T7 gene 10 (Olins and Rangwala, 1989)" CDS 5210..5236 /codon_start=1 /label=9xHis /note="9xHis affinity tag" /translation="HHHHHHHHH" CDS 5243..5896 /codon_start=1 /label=GST /note="glutathione S-transferase from Schistosoma japonicum" /translation="MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKK FELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRY GVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVL YMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPK" CDS 5918..5941 /codon_start=1 /label=HRV 3C site /note="recognition and cleavage site for human rhinovirus 3C and PreScission proteases" /translation="LEVLFQGP" CDS 5957..6676 /codon_start=1 /label=FAP-alpha-2 /note="fluorogen-activating protein composed of a dimer of the L5-MG single-chain antibody fragment (Szent-Gyorgyi et al., 2008)" /translation="QAVVTQEPSVTVSPGGTVILTCGSGTGAVTSGHYANWFQQKPGQA PRALIFDTDKKYSWTPGRFSGSLLGAKAALTISDAQPEDEAEYYCSLSDVDGYLFGGGT QLTVLSGGGGSGGGGSGGGGSGGGGSQAVVTQEPSVTVSPGGTVILTCGSGTGAVTSGH YANWFQQKPGQAPRALIFDTDKKYSWTPGRFSGSLLGAKAALTISDAQPEDEAEYYCSL SDVDGYLFGGGTQLTVLS" CDS 6712..6729 /codon_start=1 /label=6xHis /note="6xHis affinity tag" /translation="HHHHHH" terminator 6796..6843 /label=T7 terminator /note="transcription terminator for bacteriophage T7 RNA polymerase"