Basic Vector Information
- Vector Name:
- pNOV043
- Antibiotic Resistance:
- Gentamycin
- Length:
- 11403 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Wei J-R.
- Promoter:
- Pc
pNOV043 vector Vector Map
pNOV043 vector Sequence
LOCUS 40924_33427 11403 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pNOV043, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 11403) AUTHORS Wei J-R. TITLE LpxK is essential for growth of Acinetobacter baumannii ATCC 19606: relationship to toxic accumulation of lipid A pathway intermediates JOURNAL Unpublished REFERENCE 2 (bases 1 to 11403) AUTHORS Wei J-R. TITLE Direct Submission JOURNAL Submitted (11-APR-2017) Infectious Diseases, Bacteriology, Novartis Institutes for Biomedical Research, 5300 Chiron Way, Emeryville, CA 94608, USA REFERENCE 3 (bases 1 to 11403) TITLE Direct Submission REFERENCE 4 (bases 1 to 11403) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (11-APR-2017) Infectious Diseases, Bacteriology, Novartis Institutes for Biomedical Research, 5300 Chiron Way, Emeryville, CA 94608, USA" COMMENT SGRef: number: 3; type: "Journal Article" COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..11403 /mol_type="other DNA" /organism="synthetic DNA construct" regulatory 7..1337 /regulatory_class="replication_regulatory_region" regulatory 1430..1629 /regulatory_class="promoter" CDS 1630..2640 /codon_start=1 /gene="lpxK" /product="tetraacyldisaccharide 4'-kinase" /EC_number="2.7.1.130" /label=lpxK /note="LpxK; involved in lipid A biosynthesis" /protein_id="ASL05635.1" /translation="MSLAQLIQNAWNKQSSWLIVLRPLSCLYRAGFLLNRGFYSSGFKK VYTAPVPVMVIGNITVGGSGKTPLLIELVNYLKQHNVKVGVISRGYGGSGPFPMLVTSA SQAAEAGDEPALIVQSTGVPMAVGPNRQAAIELLLASTKLDLIISDDGLQHWALGRQIE WIVLDQNRGLGNRKLLPEGYLREPVERLKTSTVIEHTFTPTTTLHMHLDAGQPYLLNPS SATELSFNIQNNYHAVVGIGFPQRFYQTLKGLGVKQFQEHAFRDHHDYSIDDLLFNDDQ PIITTEKDAVKLLPLLEKHPEFKRPIWVVPVKAVLSTECYQVLNQQLQKLDIQIS" gene 1630..2640 /gene="lpxK" /label=lpxK promoter 8801..8829 /label=Pc promoter /note="class 1 integron promoter" CDS 9018..9548 /label=GmR /note="gentamycin acetyltransferase" rep_origin 9573..10000 /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" rep_origin 10139..10727 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" misc_feature complement(10913..11053) /label=bom /note="basis of mobility region from pBR322"
This page is informational only.