Price Information
Cat No. | Plasmid Name | Availability | Add to cart |
---|---|---|---|
V004308 | pNIT-1 | In stock, instant shipping |
Buy one, get one free! |
Two tubes of lyophilized plasmid will be delivered, each tube is about 5µg.
Basic Vector Information
- Vector Name:
- pNIT-1
- Antibiotic Resistance:
- Kanamycin
- Length:
- 6207 bp
- Type:
- Expression vector
- Replication origin:
- ori
- Source/Author:
- Pandey AK, Raman S, Proff R, Joshi S, Kang CM, Rubin EJ, Husson RN, Sassetti CM.
pNIT-1 vector Vector Map
Plasmid Protocol
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5. Store the plasmid at -20 ℃.
6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it
General Plasmid Transform Protocol
1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.
2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.
3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.
4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.
5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.
pNIT-1 vector Sequence
LOCUS 40924_33292 6207 bp DNA circular SYN 18-DEC-2018 DEFINITION Expression vector pNIT-1, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6207) AUTHORS Pandey AK, Raman S, Proff R, Joshi S, Kang CM, Rubin EJ, Husson RN, Sassetti CM. TITLE Nitrile-inducible gene expression in mycobacteria JOURNAL Tuberculosis (Edinb) 89 (1), 12-16 (2009) PUBMED 18801704 REFERENCE 2 (bases 1 to 6207) AUTHORS Pandey AK, Proff R, Joshi S, Sassetti CM. TITLE Direct Submission JOURNAL Submitted (01-SEP-2008) Molecular Genetics and Microbiology, University of Massachusetts Medical School, 55 Lake Avenue North. S6-141, Worcester, MA 01655, USA REFERENCE 3 (bases 1 to 6207) TITLE Direct Submission REFERENCE 4 (bases 1 to 6207) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Tuberculosis (Edinb)"; date: "2009"; volume: "89"; issue: "1"; pages: "12-16" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (01-SEP-2008) Molecular Genetics and Microbiology, University of Massachusetts Medical School, 55 Lake Avenue North. S6-141, Worcester, MA 01655, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..6207 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 141..953 /label=KanR /note="aminoglycoside phosphotransferase" rep_origin 1288..1876 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" rep_origin 2035..3930 /label=pAL5000 mycobacterial origin of replication /note="pAL5000 mycobacterial origin of replication" terminator complement(3974..4021) /label=T7 terminator /note="transcription terminator for bacteriophage T7 RNA polymerase" regulatory 4059..4173 /label=PnitA /note="PnitA" /regulatory_class="promoter" misc_feature 4174..4222 /label=multiple cloning site /note="multiple cloning site" terminator 4229..4268 /label=fd terminator /note="central terminator from bacteriophage fd (Otsuka and Kunisawa, 1982)" regulatory 4276..4390 /label=PnitA /note="PnitA" /regulatory_class="promoter" CDS 4391..5350 /codon_start=1 /gene="nitR" /product="nitrile-inducible regulatory protein" /label=nitR /protein_id="ACI22356.1" /translation="MNTFFSSDQVSAPDRVALWHDVICRSYVPLNITLTSEQPFIGTVS TGNLGTVRIATSSSLPQQITRTRRLIRQDEREYLMVGVQSAGHALVQQHGRTARVGRGG LVFWDTRHPYDILFPTDWRMSVFQFPRYSFGFTEDFIGRMTAVNVGGDRGIGRVVSSFM TSINDATDAGDLAEVASLHNSAVDLLSAAIRTELADQAAASDGLLECVLAYIRQNLADP NLCASQIAAEHNVSVRTLHRLFSATGQGVAEHIRNLRLERIKTELADPTSRRYTISALA RKWGFLDPSTFSRAFKDAYGITAREWAASASASPTEVS" gene 4391..5350 /gene="nitR" /label=nitR terminator complement(5388..5415) /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" terminator complement(5507..5593) /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene"