Basic Vector Information
- Vector Name:
- pNIA-Cc
- Antibiotic Resistance:
- Ampicillin
- Length:
- 6147 bp
- Type:
- Yeast expression vector
- Replication origin:
- ori
- Source/Author:
- Zaltsman A, Yi BY, Krichevsky A, Gafni Y, Citovsky V.
- Promoter:
- ADH1
pNIA-Cc vector Vector Map
pNIA-Cc vector Sequence
LOCUS 40924_33202 6147 bp DNA circular SYN 18-DEC-2018 DEFINITION Yeast expression vector pNIA-Cc, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6147) AUTHORS Zaltsman A, Yi BY, Krichevsky A, Gafni Y, Citovsky V. TITLE Yeast-plant coupled vector system for identification of nuclear proteins JOURNAL Plant Physiol. 145 (4), 1264-1271 (2007) PUBMED 17704231 REFERENCE 2 (bases 1 to 6147) AUTHORS Zaltsman AA, Citovsky V. TITLE Direct Submission JOURNAL Submitted (27-APR-2007) Biochemistry and Cell Bio, State University of New York, Stony Brook, NY 11777, USA REFERENCE 3 (bases 1 to 6147) TITLE Direct Submission REFERENCE 4 (bases 1 to 6147) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Plant Physiol."; date: "2007"; volume: "145"; issue: "4"; pages: "1264-1271" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (27-APR-2007) Biochemistry and Cell Bio, State University of New York, Stony Brook, NY 11777, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..6147 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 25..630 /codon_start=1 /label=LexA /note="E. coli DNA-binding protein that represses genes involved in the SOS response to DNA damage" /translation="MKALTARQQEVFDLIHDHISQTGMPPTRAEIAQRLGFRSPNAAEE HLKALARKGVIEIVSGASRGIRLLQEEEEGLPLVGRVAAGEPLLAQQHIEGHYQVDPSL FKPNADFLLRVSGMSMKDIGIMDGDLLAVHKTQDVRNGQVVVARIDDEVTVKGLEKQGN KVELLPENSEFKPIVVDLRQQSFTIEGLAVGVIRNGDWL" CDS 637..975 /codon_start=1 /label=GAL4 activation domain /note="activation domain of the GAL4 transcriptional activator" /translation="NFNQSGNIADSSLSFTFTNSSNGPNLITTQTNSQALSQPIASSNV HDNFMNNEITASKIDDGNNSKPLSPGWTDQTAYNAFGITTGMFNTTTMDDVYNYLFDDE DTPPNPKKE" misc_feature 996..1061 /label=MCS /note="multiple cloning site" polyA_signal 1185..1306 /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" CDS complement(1380..2051) /codon_start=1 /label=TRP1 /note="phosphoribosylanthranilate isomerase, required for tryptophan biosynthesis" /translation="MSVINFTGSSGPLVKVCGLQSTEAAECALDSDADLLGIICVPNRK RTIDPVIARKISSLVKAYKNSSGTPKYLVGVFRNQPKEDVLALVNDYGIDIVQLHGDES WQEYQEFLGLPVIKRLVFPKDCNILLSAASQKPHSFIPLFDSEAGGTGELLDWNSISDW VGRQESPESLHFMLAGGLTPENVGDALRLNGVIGVDVSGGVETNGVKDSNKIANFVKNA KK" promoter complement(2052..2153) /label=TRP1 promoter primer_bind complement(2167..2183) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(2191..2207) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(2215..2245) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(2260..2281) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(2569..3157) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(3331..4188) /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="[TEM beta-lactamase fragment, 45 aa] ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEAS [TEM beta-lactamase fragment, 59 aa] EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA [TEM beta-lactamase fragment, 59 aa] LIKHW" promoter complement(4189..4293) /label=AmpR promoter rep_origin 4575..5739 /label=2u ori /note="yeast 2u plasmid origin of replication" promoter 5749..6145 /label=ADH1 promoter /note="promoter for alcohol dehydrogenase 1"
This page is informational only.