pNG2 vector (V004332)

Price Information

Cat No. Plasmid Name Availability Add to cart
V004332 pNG2 In stock, 1 week for quality controls

Buy one, get one free!

Two tubes of lyophilized plasmid will be delivered, each tube is about 5µg.

Basic Vector Information

Vector Name:
pNG2
Length:
8756 bp
Type:
Cloning vector
Replication origin:
ori
Source/Author:
Gonzalez-Quinonez N, Lopez-Garcia MT, Yague P, Rioseras B, Pisciotta A, Alduina R, Manteca A.

pNG2 vector Map

pNG28756 bp4008001200160020002400280032003600400044004800520056006000640068007200760080008400oriTtraJHygromycin-B 7''-O-kinaseSCO4849regulatoryoriCAP binding sitelac promoterlac operatorM13 revfd terminatorregulatory

Plasmid Protocol

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5. Store the plasmid at -20 ℃.

6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it

General Plasmid Transform Protocol

1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.

2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.

3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.

4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.

5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.

pNG2 vector Sequence

LOCUS       V004332                 8756 bp    DNA     circular SYN 18-DEC-2018
DEFINITION  Exported.
ACCESSION   V004332
VERSION     V004332
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
            .
REFERENCE   1  (bases 1 to 8756)
  AUTHORS   Gonzalez-Quinonez N, Lopez-Garcia MT, Yague P, Rioseras B, Pisciotta
            A, Alduina R, Manteca A.
  TITLE     New PhiBT1 site-specific integrative vectors with neutral phenotype
            in Streptomyces
  JOURNAL   Appl. Microbiol. Biotechnol. 100 (6), 2797-2808 (2016)
   PUBMED   26758297
REFERENCE   2  (bases 1 to 8756)
  AUTHORS   Gonzalez-Quinonez N, Lopez-Garcia MT, Yague P, Rioseras B, Manteca
            A.
  TITLE     Direct Submission
  JOURNAL   Submitted (15-APR-2015) Biologia Funcional, Universidad de Oviedo,
            c/Julian Claveria s/n Facultad de Medicina, Oviedo 33006, Spain
REFERENCE   3  (bases 1 to 8756)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 8756)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
            SGRef: number: 1; type: "Journal Article"; journalName: "Appl.
            Microbiol. Biotechnol."; date: "2016"; volume: "100"; issue: "6";
            pages: "2797-2808"
            SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
            (15-APR-2015) Biologia Funcional, Universidad de Oviedo, c/Julian
            Claveria s/n Facultad de Medicina, Oviedo 33006, Spain"
            SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..8756
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     oriT            2150..2259
                     /label="oriT"
                     /note="incP origin of transfer"
     CDS             2292..2660
                     /label="traJ"
                     /note="oriT-recognizing protein"
     CDS             complement(3376..4371)
                     /gene="hyg"
                     /label="Hygromycin-B 7''-O-kinase"
                     /note="Hygromycin-B 7''-O-kinase from Streptomyces
                     hygroscopicus. Accession#: P09979"
     CDS             complement(5056..6366)
                     /codon_start=1
                     /gene="SCO4849"
                     /product="SCO4849 protein"
                     /label="SCO4849"
                     /protein_id="AML61763.1"
                     /translation="MVVVFVLVALLMVGVLVTANWYVWRRLFRDTTRAPGPVRRIGAAV
                     IAGGWLLAVGALVAERAGAPFWLQRVLAWPGFLWLALSIYLLLAVLAGEVVRPLLRRFL
                     ERRAAARRTAGAEPSVTPAADTSRIPAGTAPPKTPEAPETPEAPGTEALAAQGSPLAVP
                     SRRLFVSRVVAGAAAAAAVGTVGYGTYGVLSGPKVKRVTVPLAKLPRAAHGFRIAVVSD
                     IHLGPVLGRGFAQQVVDTINSTQPDLIAVVGDLVDGSVKDLGPAAAPLARLTARHGAYF
                     VTGNHEYFSGAEQWVAEVRRLGLLPLENARTELPHFDLAGVNDVAGEDEGQGPDYDRAL
                     GDRDRSRACVLLAHQPVQIHDAVDHGVDLQLSGHTHGGQLWPGNLIAGAANPTLAGLER
                     YGDTQLYVSRGAGAWGPPTRVGAPSDITVIELASRQA"
     gene            complement(5056..6366)
                     /gene="SCO4849"
                     /label="SCO4849"
     regulatory      complement(6421..6843)
                     /regulatory_class="promoter"
     rep_origin      7119..7707
                     /label="ori"
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
                     replication"
     protein_bind    7995..8016
                     /label="CAP binding site"
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     promoter        8031..8061
                     /label="lac promoter"
                     /note="promoter for the E. coli lac operon"
     protein_bind    8069..8085
                     /label="lac operator"
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be
                     relieved by adding lactose or
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     primer_bind     8093..8109
                     /label="M13 rev"
                     /note="common sequencing primer, one of multiple similar
                     variants"
     terminator      8272..8320
                     /label="fd terminator"
                     /note="central terminator from bacteriophage fd (Otsuka and
                     Kunisawa, 1982)"
     regulatory      complement(8631..8634)
                     /regulatory_class="ribosome_binding_site"