Basic Vector Information
- Vector Name:
- pNG168
- Antibiotic Resistance:
- Ampicillin
- Length:
- 8960 bp
- Type:
- Shuttle vector
- Replication origin:
- ori
- Source/Author:
- DasSarma S.
- Promoter:
- T3
pNG168 vector Map
pNG168 vector Sequence
LOCUS V004334 8960 bp DNA circular SYN 18-DEC-2018 DEFINITION Exported. ACCESSION V004334 VERSION V004334 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 8960) AUTHORS DasSarma S. TITLE Natural plasmids and plasmid vectors of halophiles JOURNAL (in) DasSarma,S., Fleischmann,E.M., Robb,F.T., Place,A.R., Sowers,K.R. and Schreier,H.J. (Eds.); ARCHAEA, A LABORATORY MANUAL - HALOPHILES: 241-250; Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY (1995) REFERENCE 2 (bases 1 to 8960) AUTHORS DasSarma S. TITLE Direct Submission JOURNAL Submitted (06-MAY-2003) Center of Marine Biotechnology, University of Maryland Biotechnology Institute, 701 E. Pratt Street, Suite 236, Baltimore, MD 21202 REFERENCE 3 (bases 1 to 8960) TITLE Direct Submission REFERENCE 4 (bases 1 to 8960) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "(in) DasSarma,S., Fleischmann,E.M., Robb,F.T., Place,A.R., Sowers,K.R. and Schreier,H.J. (Eds.)"; volume: " ARCHAEA, A LABORATORY MANUAL - HALOPHILES"; pages: " 241-250; Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY (1995" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (06-MAY-2003) Center of Marine Biotechnology, University of Maryland Biotechnology Institute, 701 E. Pratt Street, Suite 236, Baltimore, MD 21202" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..8960 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 849..3878 /codon_start=1 /gene="repH" /product="RepH" /label="repH" /note="replication protein; necessary for replication in haloarchaea" /protein_id="AAP44985.1" /translation="MHTPNQQQGIRKIVPGGTLSTAGITITEVTPRVTEWIPDLLEELL PRSIQSVRKFIRQEDPEVLTHARYNTVYRRLQEETLRFDHQEWCSTTDIWSDAEAEAVE YVESLVEFAVKYSDVDEDDLDELSEYHQQRCKSLKQTLTTISTGRGPLNAGLEALAKGP VRLHDELDDAPQPITLVLDGELWSKLDDRGTGIRALAAIAVLGSTFDVRLVISPALDAA IERRYPDWYDSHLRLTETRETSSVESAGGDGQPSAEQLEEAWEAIQNLPEESGRLRLLR NLPIEGSRDYRDLKQDDEIDVQAGTVGRYILDLEELGLVDIDRRGQYNSASLTGLGQVA VEQYVTTDYRVIHPTQSTLETHLTPTPQPQASTVYPARSDTREGDQPGTAEDWIAATGS PSEGADYVQWLDGPSGVLDAWGMHQRYLAGRRDRGVTLVDDRIERFEDGRVSYLSCFDD DLFVATQWGGPLPTLGRIAGALLSDKALSKILTPSRLGNQFEEINDAVVEQLDREAGEI IRRGHQIGWFSEDEEDYDGWRERIGSVRSLCLQQVGELTNSDDVEARTELLRDLHGLVA SATQLYYAAGVDVTINVRVPDTGMLISDERRLDDFLGFARYTIPKQSVYGIHSGYRMLL EDRPEKLKRRLPYEVDDADSTMHLTASWVFSGSTMIDLHDDIEDAIEMETNEIREAIAN GQESAPVMEIPVQIGNSYSAIRNHVEDYASAKNYQVAHQEDIHEGKQDLERLVRLFLRV LGTEDRPHRACPHDVAEAMLHVAQSSRNYDFITVRDISYGLSNLPTKRLLPELPPTATK LLKTLLDADDPMGRSEIIDTADISESSYDRYINELAAWDIIEPREIEGHRRWEAHLEPW WTPQSDRDEPYADPDPDTGILYAEFPRDVASAVMCHLITHYDLPDLETAYLEGIQPGDD IKALFDDHDRLRRWRPFLWGAFADSDKLERGPSGTAASDSTVVRLGQSPGPDTAQSSFQ DVSETATQRDRLSQPSPGLD" gene 849..3878 /gene="repH" /label="repH" protein_bind 4431..4452 /label="CAP binding site" /note="CAP binding activates transcription in the presence of cAMP." promoter 4467..4497 /label="lac promoter" /note="promoter for the E. coli lac operon" protein_bind 4505..4521 /label="lac operator" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." primer_bind 4529..4545 /label="M13 rev" /note="common sequencing primer, one of multiple similar variants" promoter 4566..4584 /label="T3 promoter" /note="promoter for bacteriophage T3 RNA polymerase" misc_feature complement(4597..4704) /label="MCS" /note="pBluescript multiple cloning site" promoter complement(4713..4731) /label="T7 promoter" /note="promoter for bacteriophage T7 RNA polymerase" primer_bind complement(4741..4757) /label="M13 fwd" /note="common sequencing primer, one of multiple similar variants" rep_origin 4899..5354 /label="f1 ori" /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" promoter 5380..5484 /label="AmpR promoter" CDS 5485..6342 /label="AmpR" /note="beta-lactamase" rep_origin 6516..7104 /direction=RIGHT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(7428..8636) /gene="hmgA" /label="3-hydroxy-3-methylglutaryl-coenzyme A reductase" /note="3-hydroxy-3-methylglutaryl-coenzyme A reductase from Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2). Accession#: Q59468"
This page is informational only.