Basic Vector Information
- Vector Name:
- pNDC_SUB4
- Antibiotic Resistance:
- Kanamycin
- Length:
- 9246 bp
- Type:
- Expression vector
- Replication origin:
- oriV
- Source/Author:
- De Coi N.
pNDC_SUB4 vector Map
pNDC_SUB4 vector Sequence
LOCUS 40924_33118 9246 bp DNA circular SYN 14-DEC-2018 DEFINITION Expression vector pNDC_SUB4, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 9246) AUTHORS De Coi N. TITLE Whole gene expression profiles of dermatophytes during infection and their virulance traits JOURNAL Thesis (2015) Centre Hospitalier Universitaire Vaudois REFERENCE 2 (bases 1 to 9246) AUTHORS De Coi N. TITLE Direct Submission JOURNAL Submitted (27-MAY-2015) Department of Dermatology, Centre Hospitalier de Lausanne (CHUV), Bugnon 48, 1011 Lausanne, SWITZERLAND REFERENCE 3 (bases 1 to 9246) TITLE Direct Submission REFERENCE 4 (bases 1 to 9246) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Thesis (2015) Centre Hospitalier Universitaire Vaudois" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (27-MAY-2015) Department of Dermatology, Centre Hospitalier de Lausanne (CHUV), Bugnon 48, 1011 Lausanne, SWITZERLAND" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..9246 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 273..1064 /label=KanR /note="aminoglycoside phosphotransferase" CDS 1366..2511 /label=trfA /note="trans-acting replication protein that binds to and activates oriV" misc_feature 2640..2664 /label=LB T-DNA repeat /note="left border repeat from nopaline C58 T-DNA" misc_feature 2698..2722 /note="LB T-DNA repeat; left border repeat from nopaline C58 T-DNA" primer_bind 2958..2974 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" CDS complement(3846..4868) /label=HygR /note="aminoglycoside phosphotransferase from E. coli" CDS complement(6263..7486) /codon_start=1 /product="subtilisin-like protease SUB4" /label=subtilisin-like protease SUB4 /note="sub4" /protein_id="CRN13537.1" /translation="MVCLKTLSVFLAAFAAADARAVFKTQGHKNSEMIPDNYIVVMKDG VSQDDFKAHISSVASIHSTNKAKRGTNTQGMKREFDIMNWRGYHGHFDRDTLEEILNDS KVDYVEQDQVVRISGLVTQRSAPSWGLGRVSHRQAGSRDYVFDDSAGRGVTIYGVDTGI DINHQDFRGRARWGTNTADRDNADRHGHGTHTASTFAGTAYGIAKNANIVAVKVLGSDG SGSTSGIIAGINYCVQDAQQRGILGKAAMNLSLGGGFSQANNDAVTRAQNAGIFVAVAA GNDNRDARNYSPASAPAVCTVASSTINDSKSSFSNWGPVELKANITSVDIYAPGSDIIA ARPGGGSTTMSGTSMASPHVAGMGAYMIGMGADPRQVCDRLKQLATAAIRNPGSSTTNR LLYNGSGQ" misc_feature 8443..8467 /label=RB T-DNA repeat /note="right border repeat from nopaline C58 T-DNA" rep_origin 8606..9237 /label=oriV /note="incP origin of replication"
This page is informational only.