Basic Vector Information
- Vector Name:
- pNam
- Antibiotic Resistance:
- Ampicillin
- Length:
- 6278 bp
- Type:
- T7 Expression vector
- Replication origin:
- pSC101 ori
- Source/Author:
- Hoang TT, Stern RJ, McNeil MR, Schweizer HP.
pNam vector Map
pNam vector Sequence
LOCUS 40924_32988 6278 bp DNA circular SYN 18-DEC-2018 DEFINITION T7 Expression vector pNam, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6278) AUTHORS Hoang TT, Stern RJ, McNeil MR, Schweizer HP. TITLE Construction and use of low-copy number T7 expression vectors for purification of problem proteins: affinity purification of Mycobacterium tuberculosis RmlD and Pseudomonas aeruginosa LasI and RhlI proteins, and functional analysis of RhlI JOURNAL Unpublished REFERENCE 2 (bases 1 to 6278) AUTHORS Hoang TT, Schweizer HP. TITLE Direct Submission JOURNAL Submitted (30-APR-1999) Microbiology, Colorado State University, Fort Collins, CO 80523, USA REFERENCE 3 (bases 1 to 6278) TITLE Direct Submission REFERENCE 4 (bases 1 to 6278) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (30-APR-1999) Microbiology, Colorado State University, Fort Collins, CO 80523, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..6278 /mol_type="other DNA" /organism="synthetic DNA construct" CDS complement(147..1004) /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="[TEM beta-lactamase fragment, 45 aa] ELDLNSGKILESFRPEERSPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS [TEM beta-lactamase fragment, 59 aa] EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA [TEM beta-lactamase fragment, 59 aa] LIKHW" promoter complement(1005..1109) /label=AmpR promoter terminator complement(1169..1216) /label=T7 terminator /note="transcription terminator for bacteriophage T7 RNA polymerase" CDS complement(1295..1450) /codon_start=1 /label=CBD /note="chitin binding domain from chitinase A1 (Watanabe et al., 1994)" /translation="TTNPGVSAWQVNTAYTAGQLVTYNGKTYKCLQPHTSLAGWEPSNV PALWQLQ" CDS complement(1490..2023) /codon_start=1 /label=Sce VMA intein 3' region /note="modified 3' region of the intein from the yeast Vma1 subunit of the vacuolar ATPase (Chong et al., 1998)" /translation="GIRNNLNTENPLWDAIVGLGFLKDGVKNIPSFLSTDNIGTRETFL AGLIDSDGYVTDEHGIKATIKTIHTSVRDGLVSLARSLGLVVSVNAEPAKVDMNVTKHK ISYAIYMSGGDVLLNVLSKCAGSKKFRPAPAAAFARECRGFYFELQELKEDDYYGITLS DDSDHQFLLGSQVVV" CDS complement(2027..2845) /codon_start=1 /label=Sce VMA intein 5' region /note="5' region of the intein from the yeast Vma1 subunit of the vacuolar ATPase (Chong et al., 1998)" /translation="CFAKGTNVLMADGSIECIENIEVGNKVMGKDGRPREVIKLPRGRE TMYSVVQKSQHRAHKSDSSREVPELLKFTCNATHELVVRTPRSVRRLSRTIKGVEYFEV ITFEMGQKKAPDGRIVELVKEVSKSYPISEGPERANELVESYRKASNKAYFEWTIEARD LSLLGSHVRKATYQTYAPILYENDHFFDYMQKSKFHLTIEGPKVLAYLLGLWIGDGLSD RATFSVDSRDTSLMERVTEYAEKLNLCAEYKDRKEPQVAKTVNLYSKVVRG" misc_feature 2846..2899 /label=multiple cloning site /note="multiple cloning site" RBS complement(2904..2926) /label=RBS /note="efficient ribosome binding site from bacteriophage T7 gene 10 (Olins and Rangwala, 1989)" protein_bind complement(2941..2965) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(2966..2984) /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" promoter 3297..3374 /label=lacI promoter CDS 3375..4454 /codon_start=1 /label=lacI /note="lac repressor" /translation="VKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAEL NYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGV EACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSIIFSH EDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSA MSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSC YIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPNTQTASPR ALADSLMQLARQVSRLESGQ" protein_bind 4470..4491 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin 4956..5178 /label=pSC101 ori /note="low-copy replication origin that requires the Rep101 protein" CDS 5226..6173 /codon_start=1 /label=Rep101 /note="RepA protein needed for replication with the pSC101 origin" /translation="MSELVVFKANELAISRYDLTEHETKLILCCVALLNPTIENPTRKE RTVSFTYNQYAQMMNISRENAYGVLAKATRELMTRTVEIRNPLVKGFEIFQWTNYAKFS SEKLELVFSEEILPYLFQLKKFIKYNLEHVKSFENKYSMRIYEWLLKELTQKKTHKANI EISLDEFKFMLMLENNYHEFKRLNQWVLKPISKDLNTYSNMKLVVDKRGRPTDTLIFQV ELDRQMDLVTELENNQIKMNGDKIPTTITSDSYLHNGLRKTLHDALTAKIQLTSFEAKF LSDMQSKYDLNGSFSWLTQKQRTTLENILAKYGRI"
This page is informational only.