Basic Vector Information
- Vector Name:
- pN-IC101
- Antibiotic Resistance:
- Ampicillin
- Length:
- 9731 bp
- Type:
- Chloroplast transformation vector
- Replication origin:
- ori
- Source/Author:
- Lin CH, Chang ML, Tzeng CC, Chen LJ.
- Promoter:
- T3
pN-IC101 vector Map
pN-IC101 vector Sequence
LOCUS V004370 9731 bp DNA circular SYN 18-DEC-2018 DEFINITION Exported. ACCESSION V004370 VERSION V004370 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 9731) AUTHORS Lin CH, Chang ML, Tzeng CC, Chen LJ. TITLE Co-transformation of the synthetic cry1A(c) and wild-type cry1C genes encoding Bacillus thuringiensis endotoxins into tobacco and their bipartite expression effects on insecticidal efficacy JOURNAL Zhi Wu Bao Hu Xue Hui Hui Kan 44, 209-232 (2002) REFERENCE 2 (bases 1 to 9731) AUTHORS Lin CH, Chen YY, Tzeng CC, Tsay HS, Chen LJ. TITLE Expression of a Bacillus thuringiensis cry1C gene in plastid confers high insecticidal efficacy against tobacco cutworm - a Spodoptera insect JOURNAL Bot. Bull. Acad. Sinica (Taiwan) 44, 199-210 (2003) REFERENCE 3 (bases 1 to 9731) AUTHORS Lin CH, Chen LJ. TITLE Direct Submission JOURNAL Submitted (17-OCT-2003) Institute of Molecular Biology, National Chung Hsing University, 250, Kuokuang Rd., Taichung, Taiwan 402, ROC REFERENCE 4 (bases 1 to 9731) TITLE Direct Submission REFERENCE 5 (bases 1 to 9731) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Zhi Wu Bao Hu Xue Hui Hui Kan 44, 209-232 (2002)" SGRef: number: 2; type: "Journal Article"; journalName: "Bot. Bull. Acad. Sinica (Taiwan) 44, 199-210 (2003)" SGRef: number: 3; type: "Journal Article"; journalName: "Submitted (17-OCT-2003) Institute of Molecular Biology, National Chung Hsing University, 250, Kuokuang Rd., Taichung, Taiwan 402, ROC" SGRef: number: 4; type: "Journal Article" FEATURES Location/Qualifiers source 1..9731 /mol_type="other DNA" /organism="synthetic DNA construct" primer_bind 121..137 /label="M13 fwd" /note="common sequencing primer, one of multiple similar variants" promoter 144..162 /label="T7 promoter" /note="promoter for bacteriophage T7 RNA polymerase" CDS 172..1446 /gene="rbcL" /label="Ribulose bisphosphate carboxylase large chain" /note="Ribulose bisphosphate carboxylase large chain from Buddleja davidii. Accession#: P36482" 3'UTR 1450..1719 /label="for rbcL mRNA 3' maturation" /note="for rbcL mRNA 3' maturation" regulatory 1742..1859 /note="Prrn promoter in tobacco plastome; corresponding to (102564..102681) or complementary(139945..140062) of the tobacco plastome in accession number NC_001879; for transcription of aadA gene" /regulatory_class="promoter" CDS 1877..2665 /label="SmR" /note="aminoglycoside adenylyltransferase (Murphy, 1985)" 3'UTR 2679..3073 /note="psbA 3'-UTR; for aadA mRNA 3' maturation; corresponds to nts 141-533 of tobacco plastome accession number NC_001879" 5'UTR 3331..3378 /note="psbA-5'UTR; for translation initiation; derived from nts 1596-1643 of tobacco plastome in accession number NC_001879" CDS 3379..5364 /codon_start=1 /gene="cry1C" /product="Cry1C" /label="cry1C" /note="toxic N terminal domain; insecticidal protein with specificity to Spodoptera insects" /protein_id="AAR14533.1" /translation="MEENNQNQCIPYNCLSNPEEVLLDGERISTGNSSIDISLSLVQFL VSNFVPGGGFLVGLIDFVWGIVGPSQWDAFLVQIEQLINERIAEFARNAAIANLEGLGN NFNIYVEAFKEWEEDPNNPATRTRVIDRFRILDGLLERDIPSFRISGFEVPLLSVYAQA ANLHLAILRDSVIFGERWGLTTINVNENYNRLIRHIDEYADHCANTYNRGLNNLPKSTY QDWITYNRLRRDLTLTVLDIAAFFPNYDNRRYPIQPVGQLTREVYTDPLINFNPQLQSV AQLPTFNVMESSAIRNPHLFDILNNLTIFTDWFSVGRNFYWGGHRVISSLIGGGNITSP IYGREANQEPPRSFTFNGPVFRTLSNPTLRLLQQPWPAPPFNLRGVEGVEFSTPTNSFT YRGRGTVDSLTELPPEDNSVPPREGYSHRLCHATFVQRSGTPFLTTGVVFSWTHRSATL TNTIDPERINQIPLVKGFRVWGGTSVITGPGFTGGDILRRNTFGDFVSLQVNINSPITQ RYRLRFRYASSRDARVIVLTGAASTGVGGQVSVNMPLQKTMEIGENLTSRTFRYTDFSN PFSFRANPDIIGISEQPLFGAGSISSGELYIDKIEIILADATFEAESDLERAQKAVNAL FTSSNQIGLKTDVTDYHIDQVSNLVE" gene 3379..5364 /gene="cry1C" /label="cry1C" primer_bind complement(5605..5621) /label="M13 fwd" /note="common sequencing primer, one of multiple similar variants" misc_feature 5735..7025 /note="homologous recombination sequence; corresponds to nts 59313-60603 of the tobacco plastome in accession number NC_001879" CDS 6215..7025 /codon_start=1 /gene="accD" /product="AccD" /label="accD" /note="ORF512" /protein_id="AAR14534.1" /translation="MTIHLLYFHANRGQENSMERWWFNSMLFKKEFERRCGLNKSMGSL GPIENTNEDPNRKVKNIHSWRNRDNSSCSNVDYLFGVKDIRNFISDDTFLVSDRNGDSY SIYFDIENHIFEIDNDHSFLSELESSFYSYRNSNYRNNGFRGEDPYYNSYMYDTQYSWN NHINSCIDSYLQSQICIDTSIISGSENYGDSYIYRAVCGGESRNSSENEGSSRRTRTKG SDLTIRESSNDLEVTQKYRHLWVQCENCYGLNYKKFLKSKMNICEQCG" gene 6215..7025 /gene="accD" /label="accD" promoter complement(7064..7082) /label="T3 promoter" /note="promoter for bacteriophage T3 RNA polymerase" primer_bind complement(7103..7119) /label="M13 rev" /note="common sequencing primer, one of multiple similar variants" protein_bind complement(7127..7143) /label="lac operator" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(7151..7181) /label="lac promoter" /note="promoter for the E. coli lac operon" protein_bind complement(7196..7217) /label="CAP binding site" /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(7505..8093) /direction=LEFT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(8267..9124) /label="AmpR" /note="beta-lactamase" promoter complement(9125..9229) /label="AmpR promoter" rep_origin complement(9255..9710) /direction=LEFT /label="f1 ori" /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis"
This page is informational only.