Basic Vector Information
- Vector Name:
- pMycoFos
- Antibiotic Resistance:
- Kanamycin
- Length:
- 12530 bp
- Type:
- Shuttle vector
- Replication origin:
- ori2
- Source/Author:
- Ly MA, Liew EF, Le NB, Coleman NV.
pMycoFos vector Map
pMycoFos vector Sequence
LOCUS 40924_32923 12530 bp DNA circular SYN 18-DEC-2018 DEFINITION Shuttle vector pMycoFos, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 12530) AUTHORS Ly MA, Liew EF, Le NB, Coleman NV. TITLE Construction and evaluation of pMycoFos, a fosmid shuttle vector for Mycobacterium spp. with inducible gene expression and copy number control JOURNAL J. Microbiol. Methods 86 (3), 320-326 (2011) PUBMED 21689690 REFERENCE 2 (bases 1 to 12530) AUTHORS Ly MA, Coleman NV. TITLE Direct Submission JOURNAL Submitted (08-OCT-2010) School of Molecular Bioscience, University of Sydney, Maze Crescent, Darlington, NSW 2006, Australia REFERENCE 3 (bases 1 to 12530) TITLE Direct Submission REFERENCE 4 (bases 1 to 12530) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "J. Microbiol. Methods"; date: "2011"; volume: "86"; issue: "3"; pages: "320-326" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (08-OCT-2010) School of Molecular Bioscience, University of Sydney, Maze Crescent, Darlington, NSW 2006, Australia" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..12530 /mol_type="other DNA" /organism="synthetic DNA construct" rep_origin 83..1979 /note="oriM; derived from pAL5000" CDS complement(2030..3103) /codon_start=1 /gene="amiC" /product="AmiC" /label=amiC /note="acetamidase regulator" /protein_id="ADR02799.1" /translation="MQDGEVEFRVGLVIPLQGPAGIFAPSCEAVAELAAKEVNDRGGLQ GRKVTIEVLDGGRPGDDVARTVADRLRGHGLDAVTGWHISAVRNRISPVVRDRIPYVYT SLYEGGERTPGVFCTGETPQIQIAPALAWLRDHFGIRSWCLVGDDYIWPRRSAAAARAY CRDLDLELRREIYVPYGTDDFRAPVRKAIASGAQAVLMLLVGQDAVLFNREFARAGGHD RMARFSPLMEENMLLASGAGSTENLYVAAAYFSSLATAGAMDLMGSYVARYGADAPPLN AMAESCYEGLVALEAIFQRAHSPEIPDLMASAHDVGFDGPRGPMCMRDSQFDQQVYIAS ADGYDFDILDTLTTLDA" gene complement(2030..3103) /gene="amiC" /label=amiC CDS 3206..3634 /codon_start=1 /gene="amiA" /product="AmiA" /label=amiA /note="acetamidase regulator" /protein_id="ADR02800.1" /translation="MAAGQQRRPNLLLPLVRLTHLAESAIERVLADSSLKIEDWRVLDE LAGRRTVPMSDLAQATLITGPTLTRTVDRLVSQGIIYRTADLHDRRRVLVALTPRGRTL RNRLVDAVAEAECAAFESCGLDVDQLRELVDTTSNLTS" gene 3206..3634 /gene="amiA" /label=amiA CDS 3714..3998 /codon_start=1 /gene="amiD" /product="AmiD" /label=amiD /note="acetamidase regulator" /protein_id="ADR02801.1" /translation="MPTYTFRCSHCGPFDLTCAISERDAAATCPECRTPARRVFGSVGL TTFTAGHHRAFDAASASAESPTVVKSIPAGADRPRAPRRNPGLPSLPRY" gene 3714..3998 /gene="amiD" /label=amiD CDS 4003..4644 /codon_start=1 /gene="amiS" /product="AmiS" /label=amiS /note="acetamidase transporter" /protein_id="ADR02802.1" /translation="MGGVGLFYVGAVLIIDGLMLLGRISPRGATPLNFFVGGLQVVTPT VLILQSGGDAAVIFAASGLYLFGFTYLWVAINNVTDWDGEGLGWFSLFVAIAALGYSWH AFTAEADPAFGVIWLLWAVLWFMLFLLLGLGHDALGPAVGFVAVAEGVITAAVPAFLIV SGNWETGPLPAAVIAVIGFAAVVLAYPIGRRLAAPSVTNPPPAALAATTR" gene 4003..4644 /gene="amiS" /label=amiS CDS 4802..5614 /label=KanR /note="aminoglycoside phosphotransferase" CDS 5757..6104 /codon_start=1 /gene="resD" /product="ResD" /label=resD /note="F plasmid resolvase" /protein_id="ADR02804.1" /translation="MERRNRRTGRTEKARIWEVTDRTVRTWIGEAVAAAAADGVTFSVP VTPHTFRHSYAMHMLYAGIPLKVLQSLMGHKSISSTEVYTKVFALDVAARHRVQFAMPE SDAVAMLKQLS" gene 5757..6104 /gene="resD" /label=resD rep_origin 6499..7113 /label=oriV /note="origin of replication for the bacterial F plasmid" rep_origin 7189..7408 /label=ori2 /note="secondary origin of replication for the bacterial F plasmid; also known as oriS" CDS 7499..8251 /label=repE /note="replication initiation protein for the bacterial F plasmid" misc_feature 8257..8507 /label=incC /note="incompatibility region of the bacterial F plasmid" CDS 8833..10005 /label=sopA /note="partitioning protein for the bacterial F plasmid" CDS 10008..10976 /label=sopB /note="partitioning protein for the bacterial F plasmid" misc_feature 11052..11525 /label=sopC /note="centromere-like partitioning region of the bacterial F plasmid" misc_feature complement(11785..12183) /label=cos /note="lambda cos site; allows packaging into phage lambda particles" protein_bind complement(12201..12234) /label=loxP /note="Cre-mediated recombination occurs in the 8-bp core sequence (ATGTATGC) (Shaw et al., 2021)."
This page is informational only.