Basic Vector Information
- Vector Name:
- pMVAX1(c)
- Antibiotic Resistance:
- Kanamycin
- Length:
- 3675 bp
- Type:
- Expression vector
- Replication origin:
- ori
- Source/Author:
- Du Y, Lu Y, Wang X, Qi J, Liu J, Hu Y, Li F, Wu J, Guo L, Liu J, Tao H, Sun W, Chen L, Cong X, Ren S, Shi J, Li J, Wang J, Huang B, Wan R.
pMVAX1(c) vector Vector Map
pMVAX1(c) vector Sequence
LOCUS 40924_32783 3675 bp DNA circular SYN 18-DEC-2018 DEFINITION Expression vector pMVAX1(c), complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 3675) AUTHORS Du Y, Lu Y, Wang X, Qi J, Liu J, Hu Y, Li F, Wu J, Guo L, Liu J, Tao H, Sun W, Chen L, Cong X, Ren S, Shi J, Li J, Wang J, Huang B, Wan R. TITLE Highly Efficient Expression of Interleukin-2 under the Control of Rabbit beta-Globin Intron II Gene Enhances Protective Immune Responses of Porcine Reproductive and Respiratory Syndrome (PRRS) DNA Vaccine in Pigs JOURNAL PLoS ONE 9 (3), E90326 (2014) PUBMED 24603502 REFERENCE 2 (bases 1 to 3675) AUTHORS Du Y, Wang X, Huang B, Liu J, Bi J, Wu X, Wu J, Guo L, Chen L, Sun W, Wang J, Wan R. TITLE Direct Submission JOURNAL Submitted (26-SEP-2013) Institute of Animal Science and Veterinary Medicine, Shandong Academy of Agricultural Sciences, Sangyuan Road No. 8, Jinan, Shandong 250100, China REFERENCE 3 (bases 1 to 3675) TITLE Direct Submission REFERENCE 4 (bases 1 to 3675) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "PLoS ONE"; date: "2014"; volume: "9"; issue: "3"; pages: "E90326" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (26-SEP-2013) Institute of Animal Science and Veterinary Medicine, Shandong Academy of Agricultural Sciences, Sangyuan Road No. 8, Jinan, Shandong 250100, China" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..3675 /mol_type="other DNA" /organism="synthetic DNA construct" enhancer 36..415 /label=CMV enhancer /note="human cytomegalovirus immediate early enhancer" promoter 416..619 /label=CMV promoter /note="human cytomegalovirus (CMV) immediate early promoter" intron 781..1353 /label=beta-globin intron /note="intron from rabbit beta-globin gene" promoter 1408..1426 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" misc_feature 1429..1487 /label=multiple cloning site /note="multiple cloning site" polyA_signal 1505..1729 /label=bGH poly(A) signal /note="bovine growth hormone polyadenylation signal" CDS 1902..2693 /codon_start=1 /label=NeoR/KanR /note="aminoglycoside phosphotransferase" /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ GLAPAELFARLKASMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF" rep_origin 3022..3610 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.