pMVAX1(c) vector (V004388)

Basic Vector Information

Vector Name:
pMVAX1(c)
Antibiotic Resistance:
Kanamycin
Length:
3675 bp
Type:
Expression vector
Replication origin:
ori
Source/Author:
Du Y, Lu Y, Wang X, Qi J, Liu J, Hu Y, Li F, Wu J, Guo L, Liu J, Tao H, Sun W, Chen L, Cong X, Ren S, Shi J, Li J, Wang J, Huang B, Wan R.

pMVAX1(c) vector Vector Map

pMVAX1(c)3675 bp60012001800240030003600CMV enhancerCMV promoterbeta-globin intronT7 promotermultiple cloning sitebGH poly(A) signalNeoR/KanRori

pMVAX1(c) vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       40924_32783        3675 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Expression vector pMVAX1(c), complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 3675)
  AUTHORS   Du Y, Lu Y, Wang X, Qi J, Liu J, Hu Y, Li F, Wu J, Guo L, Liu J, Tao
            H, Sun W, Chen L, Cong X, Ren S, Shi J, Li J, Wang J, Huang B, Wan 
            R.
  TITLE     Highly Efficient Expression of Interleukin-2 under the Control of 
            Rabbit beta-Globin Intron II Gene Enhances Protective Immune 
            Responses of Porcine Reproductive and Respiratory Syndrome (PRRS) 
            DNA Vaccine in Pigs
  JOURNAL   PLoS ONE 9 (3), E90326 (2014)
  PUBMED    24603502
REFERENCE   2  (bases 1 to 3675)
  AUTHORS   Du Y, Wang X, Huang B, Liu J, Bi J, Wu X, Wu J, Guo L, Chen L, Sun 
            W, Wang J, Wan R.
  TITLE     Direct Submission
  JOURNAL   Submitted (26-SEP-2013) Institute of Animal Science and Veterinary 
            Medicine, Shandong Academy of Agricultural Sciences, Sangyuan Road 
            No. 8, Jinan, Shandong 250100, China
REFERENCE   3  (bases 1 to 3675)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 3675)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "PLoS ONE"; 
            date: "2014"; volume: "9"; issue: "3"; pages: "E90326"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (26-SEP-2013) Institute of Animal Science and Veterinary Medicine, 
            Shandong Academy of Agricultural Sciences, Sangyuan Road No. 8, 
            Jinan, Shandong 250100, China"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..3675
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     enhancer        36..415
                     /label=CMV enhancer
                     /note="human cytomegalovirus immediate early enhancer"
     promoter        416..619
                     /label=CMV promoter
                     /note="human cytomegalovirus (CMV) immediate early
                     promoter"
     intron          781..1353
                     /label=beta-globin intron
                     /note="intron from rabbit beta-globin gene"
     promoter        1408..1426
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"
     misc_feature    1429..1487
                     /label=multiple cloning site
                     /note="multiple cloning site"
     polyA_signal    1505..1729
                     /label=bGH poly(A) signal
                     /note="bovine growth hormone polyadenylation signal"
     CDS             1902..2693
                     /codon_start=1
                     /label=NeoR/KanR
                     /note="aminoglycoside phosphotransferase"
                     /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP
                     VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS
                     SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ
                     GLAPAELFARLKASMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA
                     LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF"
     rep_origin      3022..3610
                     /direction=RIGHT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"

This page is informational only.