Basic Vector Information
- Vector Name:
- pMV361-Edim6
- Antibiotic Resistance:
- Kanamycin
- Length:
- 5641 bp
- Type:
- Shuttle vector
- Replication origin:
- ori
- Source/Author:
- Dennehy ME, Bourn W, Steele AD, Williamson A-L.
pMV361-Edim6 vector Map
pMV361-Edim6 vector Sequence
LOCUS V004391 5641 bp DNA circular SYN 18-DEC-2018 DEFINITION Exported. ACCESSION V004391 VERSION V004391 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 5641) AUTHORS Dennehy ME, Bourn W, Steele AD, Williamson A-L. TITLE Recombinant BCG expressing rotavirus VP6 partially protects mice from rotavirus challenge JOURNAL Unpublished REFERENCE 2 (bases 1 to 5641) AUTHORS Dennehy ME. TITLE Direct Submission JOURNAL Submitted (30-JUN-2005) Medical Virology, University of Cape Town, Anzio Road, Observatory, Cape Town 7925, South Africa REFERENCE 3 (bases 1 to 5641) TITLE Direct Submission REFERENCE 4 (bases 1 to 5641) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (30-JUN-2005) Medical Virology, University of Cape Town, Anzio Road, Observatory, Cape Town 7925, South Africa" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..5641 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 120..932 /label="KanR" /note="aminoglycoside phosphotransferase" rep_origin 1267..1855 /direction=RIGHT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS 2611..3723 /gene="33" /label="Integrase" /note="Integrase from Mycobacterium phage L5. Accession#: P22884" regulatory 3899..4291 /note="derived from Mycobacterium bovis hsp60 promoter of GenBank Accession Number M17705" /regulatory_class="promoter" regulatory 4256..4262 /label="derived from Mycobacterium bovis hsp60 RBS" /note="derived from Mycobacterium bovis hsp60 RBS" /regulatory_class="ribosome_binding_site" CDS 4274..5503 /codon_start=1 /product="Hsp60/VP6 chimera" /label="Hsp60/VP6 chimera" /note="first six amino acids of Mycobacterium bovis hsp60 linked to 397 amino acids of EDIM rotavirus VP6" /protein_id="AAZ16497.1" /translation="MAKTIADPAAEFMDVLYSISRTLKDARDKIVEGTLYSNVSDLIQQ FNQMLVTMNGNEFQTGGIGNLPLRNWNFDFGLLGTTLLNLDANYVESARTTIDYFVDFI DNVCMDEMMRESQRNGIAPQSDALRKLSGVKFRRINFNNSSEYIENWNLQNRRQRTGFT FHKPNIFPYSASFTLNRSQPQHDNLMGTMWLNAGSEIQVAGFDYSCAINAPANIQQFEH IVQLRRVLTTATITLLPDAERFSFPRVINSADGATTWYFNPVILRPNNVEVEFLLNGQV INTYQARFGTIVARNFDTIRLSFQLMRPPNMTPAVTALFPNAQPFEHHATVGLTLRIDS AICESVLADASETMLANVTSVRQEYAIPVGPVFPPGMNWTDLITNYSPSREDNLQRVFT VASIRSMLVK" misc_feature 4274..4291 /label="derived from Mycobacterium bovis hsp60 protein" /note="derived from Mycobacterium bovis hsp60 protein" misc_feature 4310..5503 /note="derived from EDIM rotavirus VP6 (Choi et al., 1997)" terminator 5559..5605 /label="rrnB T1 terminator" /note="transcription terminator T1 from the E. coli rrnB gene"
This page is informational only.