Basic Vector Information
- Vector Name:
- pMV3319-Edim6
- Antibiotic Resistance:
- Kanamycin
- Length:
- 5625 bp
- Type:
- Shuttle vector
- Replication origin:
- ori
- Source/Author:
- Dennehy ME, Bourn W, Steele AD, Williamson A-L.
pMV3319-Edim6 vector Vector Map
pMV3319-Edim6 vector Sequence
LOCUS V004393 5625 bp DNA circular SYN 18-DEC-2018 DEFINITION Exported. ACCESSION V004393 VERSION V004393 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 5625) AUTHORS Dennehy ME, Bourn W, Steele AD, Williamson A-L. TITLE Recombinant BCG expressing rotavirus VP6 partially protects mice from rotavirus challenge JOURNAL Unpublished REFERENCE 2 (bases 1 to 5625) AUTHORS Dennehy ME. TITLE Direct Submission JOURNAL Submitted (27-JUN-2005) Medical Virology, University of Cape Town, Anzio Road, Observatory, Cape Town 7925, South Africa REFERENCE 3 (bases 1 to 5625) TITLE Direct Submission REFERENCE 4 (bases 1 to 5625) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (27-JUN-2005) Medical Virology, University of Cape Town, Anzio Road, Observatory, Cape Town 7925, South Africa" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..5625 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 120..932 /label="KanR" /note="aminoglycoside phosphotransferase" rep_origin 1267..1855 /direction=RIGHT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS 2611..3723 /gene="33" /label="Integrase" /note="Integrase from Mycobacterium phage L5. Accession#: P22884" regulatory 3896..4136 /note="derived from Mycobacterium bovis hsp60 promoter of GenBank Accession Number M17705" /regulatory_class="promoter" CDS 4201..5487 /codon_start=1 /product="19kDa antigen/VP6 chimera" /label="19kDa antigen/VP6 chimera" /note="21 amino acids of Mycobacterium tuberculosis 19 kDa signal sequence, first 7 amino acids of 19 kDa mature-protein, 3 additional amino acids and 397 amino acids of rotavirus EDIM VP6" /protein_id="AAZ16495.1" /translation="MKRGLTVAVAGAAILVAGLSGCSSNKSTDPKMDVLYSISRTLKDA RDKIVEGTLYSNVSDLIQQFNQMLVTMNGNEFQTGGIGNLPLRNWNFDFGLLGTTLLNL DANYVESARTTIDYFVDFIDNVCMDEMMRESQRNGIAPQSDALRKLSGVKFRRINFNNS SEYIENWNLQNRRQRTGFTFHKPNIFPYSASFTLNRSQPQHDNLMGTMWLNAGSEIQVA GFDYSCAINAPANIQQFEHIVQLRRVLTTATITLLPDAERFSFPRVINSADGATTWYFN PVILRPNNVEVEFLLNGQVINTYQARFGTIVARNFDTIRLSFQLMRPPNMTPAVTALFP NAQPFEHHATVGLTLRIDSAICESVLADASETMLANVTSVRQEYAIPVGPVFPPGMNWT DLITNYSPSREDNLQRVFTVASIRSMLVK" misc_feature 4201..4284 /note="derived from Mycobacterium tuberculosis 19 kDa protein of GenBank Accession Number J03838" sig_peptide 4201..4263 /note="derived from Mycobacterium tuberculosis 19 kDa signal peptide" misc_feature 4294..5487 /note="derived from rotavirus EDIM VP6 of GenBank Accession Number U65988" terminator 5543..5589 /label="rrnB T1 terminator" /note="transcription terminator T1 from the E. coli rrnB gene"
This page is informational only.