Basic Vector Information
- Vector Name:
- pMUTcJUN
- Antibiotic Resistance:
- Kanamycin
- Length:
- 5331 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Zheng C-F.
- Promoter:
- CMV
pMUTcJUN vector Map
pMUTcJUN vector Sequence
LOCUS 40924_32743 5331 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pMUTcJUN, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5331) AUTHORS Zheng C-F. TITLE pMUTcJUN JOURNAL Unpublished REFERENCE 2 (bases 1 to 5331) AUTHORS Zheng C-F. TITLE Direct Submission JOURNAL Submitted (06-MAY-1998) Technical Services, Stratagene, 11011 N. Torrey Pines Rd., La Jolla, CA 92037, USA REFERENCE 3 (bases 1 to 5331) TITLE Direct Submission REFERENCE 4 (bases 1 to 5331) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (06-MAY-1998) Technical Services, Stratagene, 11011 N. Torrey Pines Rd., La Jolla, CA 92037, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..5331 /mol_type="other DNA" /organism="synthetic DNA construct" enhancer 67..370 /label=CMV enhancer /note="human cytomegalovirus immediate early enhancer" promoter 371..574 /label=CMV promoter /note="human cytomegalovirus (CMV) immediate early promoter" CDS 642..1082 /codon_start=1 /label=GAL4 DNA binding domain /note="DNA binding domain of the GAL4 transcriptional activator" /translation="MKLLSSIEQACDICRLKKLKCSKEKPKCAKCLKNNWECRYSPKTK RSPLTRAHLTEVESRLERLEQLFLLIFPREDLDMILKMDSLQDIKALLTGLFVQDNVNK DAVTDRLASVETDMPLTLRQHRISATSSSEESSNKGQRQLTVS" CDS complement(1122..1133) /codon_start=1 /label=Factor Xa site /note="Factor Xa recognition and cleavage site" /translation="IEGR" polyA_signal 2125..2246 /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" rep_origin complement(2253..2708) /direction=LEFT /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" promoter 2735..2839 /label=AmpR promoter promoter 2841..3198 /label=SV40 promoter /note="SV40 enhancer and early promoter" CDS 3233..4024 /codon_start=1 /label=NeoR/KanR /note="aminoglycoside phosphotransferase" /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ GLAPAELFARLKASMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF" polyA_signal 4259..4306 /label=HSV TK poly(A) signal /note="herpes simplex virus thymidine kinase polyadenylation signal (Cole and Stacy, 1985)" rep_origin 4635..5223 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.