Basic Vector Information
- Vector Name:
- pMU1810
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 10413 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Host:
- Yeast
- Source/Author:
- Mearls EB, Olson DG, Herring CD, Lynd LR.
- Promoter:
- URA3
pMU1810 vector Vector Map
pMU1810 vector Sequence
LOCUS V004408 10413 bp DNA circular SYN 18-DEC-2018 DEFINITION Exported. ACCESSION V004408 VERSION V004408 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 10413) AUTHORS Mearls EB, Olson DG, Herring CD, Lynd LR. TITLE Development of a regulatable plasmid-based gene expression system for Clostridium thermocellum JOURNAL Appl. Microbiol. Biotechnol. 99 (18), 7589-7599 (2015) PUBMED 25994254 REFERENCE 2 (bases 1 to 10413) AUTHORS Argyros A, Mearls EB. TITLE Direct Submission JOURNAL Submitted (13-MAR-2013) Engineering, Dartmouth College, 14 Engineering Dr, Hanover, NH 03755, USA REFERENCE 3 (bases 1 to 10413) TITLE Direct Submission REFERENCE 4 (bases 1 to 10413) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Appl. Microbiol. Biotechnol."; date: "2015"; volume: "99"; issue: "18"; pages: "7589-7599" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (13-MAR-2013) Engineering, Dartmouth College, 14 Engineering Dr, Hanover, NH 03755, USA" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..10413 /mol_type="other DNA" /organism="synthetic DNA construct" CDS complement(294..1094) /label="URA3" /note="orotidine-5'-phosphate decarboxylase, required for uracil biosynthesis" promoter complement(1095..1315) /label="URA3 promoter" misc_feature 1343..1846 /label="CEN/ARS" /note="S. cerevisiae CEN6 centromere fused to an autonomously replicating sequence" misc_recomb 1888..3099 /label="spo0A 3' flank for homologous recombination" /note="spo0A 3' flank for homologous recombination" misc_recomb 3100..4192 /label="spo0A 5' flank for homologous recombination" /note="spo0A 5' flank for homologous recombination" CDS complement(4311..4856) /codon_start=1 /gene="hpt" /product="Hpt" /label="hpt" /note="hypoxanthine phosphoribosyl transferase" /protein_id="AGT95731.1" /translation="MENLSKDIDEILITEEELKEKIKELGRQITKDYKGKNLMLVGVLK GALMFMADLSRHIDLPLSLDFMAVSSYGSSTHSSGIVKIIKDLDISIEGKDVLIVEDII DSGLTLSYLRETLLGRKPKSLKICTILDKPERREASVKVDYVGFKIPDKFVVGYGLDFD EKYRNLPFIGVLKPEMYS" gene complement(4311..4856) /gene="hpt" /label="hpt" CDS complement(4882..5529) /gene="cat" /label="Chloramphenicol acetyltransferase" /note="Chloramphenicol acetyltransferase from Staphylococcus aureus. Accession#: P00485" regulatory complement(5530..6057) /gene="gapD" /regulatory_class="promoter" gene complement(5530..6057) /gene="gapD" /label="gapD" misc_feature 6058..6800 /note="fragment of Spo0A; sporulation master regulator-like protein" CDS complement(6801..7379) /codon_start=1 /gene="tdk" /product="Tdk" /label="tdk" /note="thymidine kinase" /protein_id="AGT95733.1" /translation="MYGPKDHGYIEVVTGPMFSGKSEELIRRIKRAKIARQKVQVFKPA IDDRYSIDKVVSHNGDNMHAIAIVKASDILAYAEEDTDVFAIDEVQFFDSEIVDIVKEI ADSGKRVICAGLDMDFRGEPFGPTPELMAIAEFVDKLTAICMKCGNPATRTQRLINGKP ANYDDPIIMVGAKESYEARCRKCHEVPRT" gene complement(6801..7379) /gene="tdk" /label="tdk" regulatory complement(7380..8000) /gene="cbp" /regulatory_class="promoter" gene complement(7380..8000) /gene="cbp" /label="cbp" CDS complement(8110..9111) /label="repB" /note="RepB replication protein" rep_origin complement(9803..10391) /direction=LEFT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.