Basic Vector Information
- Vector Name:
- pMTL83353
- Antibiotic Resistance:
- Streptomycin
- Length:
- 4941 bp
- Type:
- Shuttle vector
- Replication origin:
- ori
- Source/Author:
- Heap JT, Pennington OJ, Cartman ST, Minton NP.
pMTL83353 vector Map
pMTL83353 vector Sequence
LOCUS 40924_32658 4941 bp DNA circular SYN 18-DEC-2018 DEFINITION Shuttle vector pMTL83353, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4941) AUTHORS Heap JT, Pennington OJ, Cartman ST, Minton NP. TITLE A modular system for Clostridium shuttle plasmids JOURNAL J. Microbiol. Methods 78 (1), 79-85 (2009) PUBMED 19445976 REFERENCE 2 (bases 1 to 4941) AUTHORS Pennington OJ, Heap JT, Cartman ST, Minton NP. TITLE Direct Submission JOURNAL Submitted (02-MAR-2009) Centre for Biomolecular Sciences, The University of Nottingham, University Park, Nottingham NG7 2RD, United Kingdom REFERENCE 3 (bases 1 to 4941) TITLE Direct Submission REFERENCE 4 (bases 1 to 4941) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "J. Microbiol. Methods"; date: "2009"; volume: "78"; issue: "1"; pages: "79-85" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (02-MAR-2009) Centre for Biomolecular Sciences, The University of Nottingham, University Park, Nottingham NG7 2RD, United Kingdom" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..4941 /mol_type="other DNA" /organism="synthetic DNA construct" regulatory 9..62 /note="terminator derived from CD0164 gene of Clostridium difficile" /regulatory_class="terminator" primer_bind 63..79 /label=M13 rev /note="common sequencing primer, one of multiple similar variants" regulatory 89..288 /note="promoter derived from fdx gene of Clostridium sporogenes" /regulatory_class="promoter" RBS 274..282 /label=Shine-Dalgarno sequence /note="full consensus sequence for ribosome-binding sites upstream of start codons in E. coli; complementary to a region in the 3' end of the 16S rRNA (Chen et al., 1994)" primer_bind complement(393..409) /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" regulatory 557..598 /note="terminator derived from fdx gene of Clostridium pasteurianum" /regulatory_class="terminator" CDS 1325..1642 /codon_start=1 /gene="repH" /product="putative plasmid replication protein" /label=repH /protein_id="ACR43901.1" /translation="MKRRAYMKTCKNCKEFIKDTEICKIHSLMIHDKTVATYCSKYNES RCLHKGKVQCINCSKMNRYGWCAIKMRCFTEEEQKKERTCIKYYARSFKKAHVKKSKKK K" gene 1325..1642 /gene="repH" /label=repH CDS 2434..3186 /codon_start=1 /gene="aad9" /product="spectinomycin resistance protein" /label=aad9 /protein_id="ACR43899.1" /translation="MNTYEQINKVKKILRKHLKNNLIGTYMFGSGVESGLKPNSDLDFL VVVSEPLTDQSKEILIQKIRPISKKIGDKSNLRYIELTIIIQQEMVPWNHPPKQEFIYG EWLQELYEQGYIPQKELNSDLTIMLYQAKRKNKRIYGNYDLEELLPDIPFSDVRRAIMD SSEELIDNYQDDETNSILTLCRMILTMDTGKIIPKDIAGNAVAESSPLEHRERILLAVR SYLGENIEWTNENVNLTINYLNNRLKKL" gene 2434..3186 /gene="aad9" /label=aad9 rep_origin 3385..3973 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" oriT 4294..4403 /label=oriT /note="incP origin of transfer" CDS 4436..4804 /label=traJ /note="oriT-recognizing protein"
This page is informational only.