pMTL82254 vector (V004417)

Price Information

Cat No. Plasmid Name Availability Add to cart
V004417 pMTL82254 In stock, instant shipping

Buy one, get one free!

Two tubes of lyophilized plasmid will be delivered, each tube is about 5µg.

Basic Vector Information

promoter-less catP reporter plasmid

Vector Name:
pMTL82254
Antibiotic Resistance:
Erythromycin
Length:
5935 bp
Type:
Shuttle vector
Replication origin:
ori
Source/Author:
Heap JT, Pennington OJ, Cartman ST, Minton NP.
Growth Strain(s):
Stbl3
Growth Temperature:
37℃

pMTL82254 vector Map

pMTL822545935 bp60012001800240030003600420048005400terminator derived from CD0164 gene of Clostridium difficileM13 revChloramphenicol acetyltransferaseM13 fwdterminator derived from fdx gene of Clostridium pasteurianumrepAorf2rRNA adenine N-6-methyltransferaseorioriTtraJ

Plasmid Protocol

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5. Store the plasmid at -20 ℃.

6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it

General Plasmid Transform Protocol

1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.

2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.

3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.

4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.

5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.

References

  • Heap JT, Pennington OJ, Cartman ST, Minton NP. A modular system for Clostridium shuttle plasmids. J Microbiol Methods. 2009 Jul;78(1):79-85. doi: 10.1016/j.mimet.2009.05.004. Epub 2009 May 13. PMID: 19445976.

pMTL82254 vector Sequence

LOCUS       V004417                 5935 bp    DNA     circular SYN 18-DEC-2018
DEFINITION  Exported.
ACCESSION   V004417
VERSION     V004417
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
            .
REFERENCE   1  (bases 1 to 5935)
  AUTHORS   Heap JT, Pennington OJ, Cartman ST, Minton NP.
  TITLE     A modular system for Clostridium shuttle plasmids
  JOURNAL   J. Microbiol. Methods 78 (1), 79-85 (2009)
   PUBMED   19445976
REFERENCE   2  (bases 1 to 5935)
  AUTHORS   Pennington OJ, Heap JT, Cartman ST, Minton NP.
  TITLE     Direct Submission
  JOURNAL   Submitted (02-MAR-2009) Centre for Biomolecular Sciences, The
            University of Nottingham, University Park, Nottingham NG7 2RD,
            United Kingdom
REFERENCE   3  (bases 1 to 5935)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 5935)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "J.
            Microbiol. Methods"; date: "2009"; volume: "78"; issue: "1"; pages:
            "79-85"
            SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
            (02-MAR-2009) Centre for Biomolecular Sciences, The University of
            Nottingham, University Park, Nottingham NG7 2RD, United Kingdom"
            SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..5935
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     regulatory      9..62
                     /note="terminator derived from CD0164 gene of Clostridium
                     difficile"
                     /regulatory_class="terminator"
     primer_bind     63..79
                     /label="M13 rev"
                     /note="common sequencing primer, one of multiple similar
                     variants"
     CDS             98..718
                     /gene="catP"
                     /label="Chloramphenicol acetyltransferase"
                     /note="Chloramphenicol acetyltransferase from Clostridium
                     perfringens. Accession#: P26826"
     primer_bind     complement(767..783)
                     /label="M13 fwd"
                     /note="common sequencing primer, one of multiple similar
                     variants"
     regulatory      931..972
                     /note="terminator derived from fdx gene of Clostridium
                     pasteurianum"
                     /regulatory_class="terminator"
     CDS             1493..2548
                     /codon_start=1
                     /gene="repA"
                     /product="plasmid replication protein"
                     /label="repA"
                     /protein_id="ACR43890.1"
                     /translation="MTNYNQKNENKQEVKTALEKCTDKKRKNPRFTSYIAPLTTKKNIE
                     RTSTCGDYLFMLSDADLEHFKLHKGNFCGNRFCPMCSWRLACKDSLEISILMEHLRKEE
                     NKEFIFLTLTTPNVKSYDLNYSIKQYNKSFKKLMERKEVKDITKGYIRKLEVTYQKEKY
                     ITKDLWKIKKDYYQKKGLEIGDLEPNFDTYNPHFHVVIAVNKSYFTDKNYYINRERWLE
                     LWKFATKDDSITQVDVRKAKINDYKEVYELAKYSAKDTDYLISRPVFEIFYKALKGKQV
                     LVFSGFFKDAHKLYKQGKLDVYKKKDEIKYVYIVYYNWCKKQYEKTRIRELTEDEKEEL
                     NQDLIDEIEID"
     gene            1493..2548
                     /gene="repA"
                     /label="repA"
     CDS             complement(2639..3142)
                     /codon_start=1
                     /product="putative plasmid replication protein"
                     /label="putative plasmid replication protein"
                     /note="orf2"
                     /protein_id="ACR43893.1"
                     /translation="MKFKKIILYIFIVIIPLSITGCSINQITTPVPKNYLDNIVKKYVG
                     PEGVQPSFGGKTFYDYKIIDSEKSKNIIKIYLYYIGQEYYIEDDKLVEGTGSASFATVT
                     IKKENNNYKLVSYEVPKSPAQEDTVKIFPKSVRKKAIHANTPSLKNIEKEAETYFKKEL
                     KTKN"
     CDS             3488..4222
                     /gene="ermBP"
                     /label="rRNA adenine N-6-methyltransferase"
                     /note="rRNA adenine N-6-methyltransferase from Enterococcus
                     faecalis. Accession#: P0A4D5"
     rep_origin      4379..4967
                     /direction=RIGHT
                     /label="ori"
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
                     replication"
     oriT            5288..5397
                     /label="oriT"
                     /note="incP origin of transfer"
     CDS             5430..5798
                     /label="traJ"
                     /note="oriT-recognizing protein"