Basic Vector Information
Plasmid vector pMTL-SC7215, used for allele exchange in C. difficile R20291. Note that pMTL-SC7215 and pMTL-SC7315 are identical except that they have the pBP1 and pCB102 Gram-positive replicons, respectively (between AscI and FseI restriction sites).
- Vector Name:
- pMTL-SC7215
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 6778 bp
- Type:
- C. difficile
- Replication origin:
- ori
- Source/Author:
- Cartman ST, Kelly ML, Heeg D, Heap JT, Minton NP.
- Growth Strain(s):
- DH5alpha
- Growth Temperature:
- 37℃
pMTL-SC7215 vector Map
pMTL-SC7215 vector Sequence
LOCUS V004427 6778 bp DNA circular SYN 04-JAN-2024 DEFINITION Exported. ACCESSION V004427 VERSION V004427 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 6778) AUTHORS . TITLE Direct Submission FEATURES Location/Qualifiers source 1..6778 /mol_type="other DNA" /organism="synthetic DNA construct" primer_bind 63..79 /label="M13 rev" /note="common sequencing primer, one of multiple similar variants" protein_bind complement(254..278) /label="lac operator" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." RBS 297..305 /label="Shine-Dalgarno sequence" /note="full consensus sequence for ribosome-binding sites upstream of start codons in E. coli; complementary to a region in the 3' end of the 16S rRNA (Chen et al., 1994)" CDS 318..1598 /label="codA" /note="E. coli cytosine deaminase" primer_bind complement(1723..1739) /label="M13 fwd" /note="common sequencing primer, one of multiple similar variants" CDS 2449..3504 /codon_start=1 /gene="repA" /product="plasmid replication protein" /label="repA" /protein_id="ACR43886.1" /translation="MTNYNQKNENKQEVKTALEKCTDKKRKNPRFTSYIAPLTTKKNIE RTSTCGDYLFMLSDADLEHFKLHKGNFCGNRFCPMCSWRLACKDSLEISILMEHLRKEE NKEFIFLTLTTPNVKSYDLNYSIKQYNKSFKKLMERKEVKDITKGYIRKLEVTYQKEKY ITKDLWKIKKDYYQKKGLEIGDLEPNFDTYNPHFHVVIAVNKSYFTDKNYYINRERWLE LWKFATKDDSITQVDVRKAKINDYKEVYELAKYSAKDTDYLISRPVFEIFYKALKGKQV LVFSGFFKDAHKLYKQGKLDVYKKKDEIKYVYIVYYNWCKKQYEKTRIRELTEDEKEEL NQDLIDEIEID" gene 2449..3504 /gene="repA" /label="repA" CDS complement(3595..4098) /codon_start=1 /product="putative plasmid replication protein" /label="putative plasmid replication protein" /note="orf2" /protein_id="ACR43887.1" /translation="MKFKKIILYIFIVIIPLSITGCSINQITTPVPKNYLDNIVKKYVG PEGVQPSFGGKTFYDYKIIDSEKSKNIIKIYLYYIGQEYYIEDDKLVEGTGSASFATVT IKKENNNYKLVSYEVPKSPAQEDTVKIFPKSVRKKAIHANTPSLKNIEKEAETYFKKEL KTKN" CDS 4422..5042 /gene="catP" /label="Chloramphenicol acetyltransferase" /note="Chloramphenicol acetyltransferase from Clostridium perfringens. Accession#: P26826" rep_origin 5222..5810 /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" oriT 6131..6240 /label="oriT" /note="incP origin of transfer" CDS 6273..6641 /label="traJ" /note="oriT-recognizing protein"
This page is informational only.