Price Information
Cat No. | Plasmid Name | Availability | Add to cart |
---|---|---|---|
V004428 | pMTL-JH4 | In stock, 1 week for quality controls |
Buy one, get one free! |
Two tubes of lyophilized plasmid will be delivered, each tube is about 5µg.
Basic Vector Information
- Vector Name:
- pMTL-JH4
- Length:
- 4863 bp
- Type:
- Integration vector
- Replication origin:
- ori
- Source/Author:
- Heap JT, Ehsaan M, Cooksley CM, Ng YK, Cartman ST, Winzer K, Minton NP.
pMTL-JH4 vector Map
Plasmid Protocol
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5. Store the plasmid at -20 ℃.
6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it
General Plasmid Transform Protocol
1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.
2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.
3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.
4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.
5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.
pMTL-JH4 vector Sequence
LOCUS V004428 4863 bp DNA circular SYN 18-DEC-2018 DEFINITION Exported. ACCESSION V004428 VERSION V004428 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 4863) AUTHORS Heap JT, Ehsaan M, Cooksley CM, Ng YK, Cartman ST, Winzer K, Minton NP. TITLE Integration of DNA into bacterial chromosomes from plasmids without a counter-selection marker JOURNAL Nucleic Acids Res. 40 (8), E59 (2012) PUBMED 22259038 REFERENCE 2 (bases 1 to 4863) AUTHORS Heap JT, Ehsaan M, Cooksley CM, Cartman ST, Minton NP. TITLE Direct Submission JOURNAL Submitted (11-JAN-2011) School of Molecular Medical Sciences, The University of Nottingham, Centre for Biomolecular Sciences, University Park, Nottingham, Nottinghamshire NG7 2RD, United Kingdom REFERENCE 3 (bases 1 to 4863) TITLE Direct Submission REFERENCE 4 (bases 1 to 4863) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nucleic Acids Res."; date: "2012"; volume: "40"; issue: "8"; pages: "E59" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (11-JAN-2011) School of Molecular Medical Sciences, The University of Nottingham, Centre for Biomolecular Sciences, University Park, Nottingham, Nottinghamshire NG7 2RD, United Kingdom" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..4863 /mol_type="other DNA" /organism="synthetic DNA construct" gene 9..822 /gene="pyrF fragment" /label="pyrF fragment" misc_feature 9..306 /gene="pyrF fragment" /note="mediates homologous recombination with the chromosome of Clostridium acetobutylicum ATCC824" primer_bind complement(941..957) /label="M13 fwd" /note="common sequencing primer, one of multiple similar variants" CDS 1122..1859 /gene="pyrK" /label="Dihydroorotate dehydrogenase B (NAD(+)), electron transfer subunit" /note="Dihydroorotate dehydrogenase B (NAD(+)), electron transfer subunit from Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787). Accession#: Q97FS6" gene 1855..2304 /gene="pyrD fragment" /label="pyrD fragment" CDS 2683..3123 /codon_start=1 /gene="repL" /product="plasmid replication protein" /label="repL" /protein_id="AFA34931.1" /translation="MKERYGTVYKGSQRLIDEESGEVIEVDKLYRKQTSGNFVKAYIVQ LISMLDMIGGKKLKIVNYILDNVHLSNNTMIATTREIAKATGTSLQTVITTLKILEEGN IIKRKTGVLMLNPELLMRGDDQKQKYLLLEFGNFEQEANEID" gene 2683..3123 /gene="repL" /label="repL" CDS 3273..3893 /gene="catP" /label="Chloramphenicol acetyltransferase" /note="Chloramphenicol acetyltransferase from Clostridium perfringens. Accession#: P26826" rep_origin 4073..4661 /direction=RIGHT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"