pMTL-JH2 vector (V004437)

LOCUS       V004437                 4353 bp    DNA     circular SYN 18-DEC-2018
DEFINITION  Exported.
ACCESSION   V004437
VERSION     V004437
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
            .
REFERENCE   1  (bases 1 to 4353)
  AUTHORS   Heap JT, Ehsaan M, Cooksley CM, Ng YK, Cartman ST, Winzer K, Minton
            NP.
  TITLE     Integration of DNA into bacterial chromosomes from plasmids without
            a counter-selection marker
  JOURNAL   Nucleic Acids Res. 40 (8), E59 (2012)
   PUBMED   22259038
REFERENCE   2  (bases 1 to 4353)
  AUTHORS   Heap JT, Ehsaan M, Cooksley CM, Cartman ST, Minton NP.
  TITLE     Direct Submission
  JOURNAL   Submitted (11-JAN-2011) School of Molecular Medical Sciences, The
            University of Nottingham, Centre for Biomolecular Sciences,
            University Park, Nottingham, Nottinghamshire NG7 2RD, United Kingdom
REFERENCE   3  (bases 1 to 4353)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 4353)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Nucleic
            Acids Res."; date: "2012"; volume: "40"; issue: "8"; pages: "E59"
            SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
            (11-JAN-2011) School of Molecular Medical Sciences, The University
            of Nottingham, Centre for Biomolecular Sciences, University Park,
            Nottingham, Nottinghamshire NG7 2RD, United Kingdom"
            SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..4353
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     misc_feature    9..306
                     /gene="pyrF fragment"
                     /note="mediates homologous recombination with the
                     chromosome of Clostridium acetobutylicum ATCC824"
     gene            9..306
                     /gene="pyrF fragment"
                     /label="pyrF fragment"
     primer_bind     complement(431..447)
                     /label="M13 fwd"
                     /note="common sequencing primer, one of multiple similar
                     variants"
     CDS             612..1349
                     /gene="pyrK"
                     /label="Dihydroorotate dehydrogenase B (NAD(+)), electron
                     transfer subunit"
                     /note="Dihydroorotate dehydrogenase B (NAD(+)), electron
                     transfer subunit from Clostridium acetobutylicum (strain
                     ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787).
                     Accession#: Q97FS6"
     gene            1345..1794
                     /gene="pyrD fragment"
                     /label="pyrD fragment"
     CDS             2173..2613
                     /codon_start=1
                     /gene="repL"
                     /product="plasmid replication protein"
                     /label="repL"
                     /protein_id="AFA34925.1"
                     /translation="MKERYGTVYKGSQRLIDEESGEVIEVDKLYRKQTSGNFVKAYIVQ
                     LISMLDMIGGKKLKIVNYILDNVHLSNNTMIATTREIAKATGTSLQTVITTLKILEEGN
                     IIKRKTGVLMLNPELLMRGDDQKQKYLLLEFGNFEQEANEID"
     gene            2173..2613
                     /gene="repL"
                     /label="repL"
     CDS             2763..3383
                     /gene="catP"
                     /label="Chloramphenicol acetyltransferase"
                     /note="Chloramphenicol acetyltransferase from Clostridium
                     perfringens. Accession#: P26826"
     rep_origin      3563..4151
                     /direction=RIGHT
                     /label="ori"
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
                     replication"