Basic Vector Information
- Vector Name:
- pMTL-JH19
- Length:
- 4942 bp
- Type:
- Integration vector
- Replication origin:
- ori
- Source/Author:
- Heap JT, Ehsaan M, Cooksley CM, Ng YK, Cartman ST, Winzer K, Minton NP.
pMTL-JH19 vector Vector Map
pMTL-JH19 vector Sequence
LOCUS V004438 4942 bp DNA circular SYN 18-DEC-2018 DEFINITION Exported. ACCESSION V004438 VERSION V004438 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 4942) AUTHORS Heap JT, Ehsaan M, Cooksley CM, Ng YK, Cartman ST, Winzer K, Minton NP. TITLE Integration of DNA into bacterial chromosomes from plasmids without a counter-selection marker JOURNAL Nucleic Acids Res. 40 (8), E59 (2012) PUBMED 22259038 REFERENCE 2 (bases 1 to 4942) AUTHORS Heap JT, Ehsaan M, Cooksley CM, Cartman ST, Minton NP. TITLE Direct Submission JOURNAL Submitted (11-JAN-2011) School of Molecular Medical Sciences, The University of Nottingham, Centre for Biomolecular Sciences, University Park, Nottingham, Nottinghamshire NG7 2RD, United Kingdom REFERENCE 3 (bases 1 to 4942) TITLE Direct Submission REFERENCE 4 (bases 1 to 4942) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nucleic Acids Res."; date: "2012"; volume: "40"; issue: "8"; pages: "E59" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (11-JAN-2011) School of Molecular Medical Sciences, The University of Nottingham, Centre for Biomolecular Sciences, University Park, Nottingham, Nottinghamshire NG7 2RD, United Kingdom" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..4942 /mol_type="other DNA" /organism="synthetic DNA construct" gene 9..546 /gene="pyrE fragment" /label="pyrE fragment" misc_feature 9..308 /gene="pyrE fragment" /note="mediates homologous recombination with the chromosome of Clostridium difficile 630" primer_bind complement(665..681) /label="M13 fwd" /note="common sequencing primer, one of multiple similar variants" regulatory 829..870 /label="derived from fdx gene of Clostridium pasteurianum" /note="derived from fdx gene of Clostridium pasteurianum" /regulatory_class="terminator" CDS 1597..1914 /codon_start=1 /gene="repH" /product="plasmid replication protein" /label="repH" /protein_id="AFA34966.1" /translation="MKRRAYMKTCKNCKEFIKDTEICKIHSLMIHDKTVATYCSKYNES RCLHKGKVQCINCSKMNRYGWCAIKMRCFTEEEQKKERTCIKYYARSFKKAHVKKSKKK K" gene 1597..1914 /gene="repH" /label="repH" CDS 2586..3206 /gene="catP" /label="Chloramphenicol acetyltransferase" /note="Chloramphenicol acetyltransferase from Clostridium perfringens. Accession#: P26826" rep_origin 3386..3974 /direction=RIGHT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" oriT 4295..4404 /label="oriT" /note="incP origin of transfer" CDS 4437..4805 /label="traJ" /note="oriT-recognizing protein"
This page is informational only.