Basic Vector Information
- Vector Name:
- pMTL-JH18
- Length:
- 5862 bp
- Type:
- Integration vector
- Replication origin:
- ori
- Source/Author:
- Heap JT, Ehsaan M, Cooksley CM, Ng YK, Cartman ST, Winzer K, Minton NP.
pMTL-JH18 vector Vector Map
pMTL-JH18 vector Sequence
LOCUS V004439 5862 bp DNA circular SYN 18-DEC-2018 DEFINITION Exported. ACCESSION V004439 VERSION V004439 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 5862) AUTHORS Heap JT, Ehsaan M, Cooksley CM, Ng YK, Cartman ST, Winzer K, Minton NP. TITLE Integration of DNA into bacterial chromosomes from plasmids without a counter-selection marker JOURNAL Nucleic Acids Res. 40 (8), E59 (2012) PUBMED 22259038 REFERENCE 2 (bases 1 to 5862) AUTHORS Heap JT, Ehsaan M, Cooksley CM, Cartman ST, Minton NP. TITLE Direct Submission JOURNAL Submitted (11-JAN-2011) School of Molecular Medical Sciences, The University of Nottingham, Centre for Biomolecular Sciences, University Park, Nottingham, Nottinghamshire NG7 2RD, United Kingdom REFERENCE 3 (bases 1 to 5862) TITLE Direct Submission REFERENCE 4 (bases 1 to 5862) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nucleic Acids Res."; date: "2012"; volume: "40"; issue: "8"; pages: "E59" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (11-JAN-2011) School of Molecular Medical Sciences, The University of Nottingham, Centre for Biomolecular Sciences, University Park, Nottingham, Nottinghamshire NG7 2RD, United Kingdom" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..5862 /mol_type="other DNA" /organism="synthetic DNA construct" misc_feature 9..308 /gene="pyrE fragment" /note="mediates homologous recombination with the chromosome of Clostridium difficile 630" gene 9..308 /gene="pyrE fragment" /label="pyrE fragment" primer_bind complement(427..443) /label="M13 fwd" /note="common sequencing primer, one of multiple similar variants" misc_feature 591..1790 /note="mediates homologous recombination with the chromosome of Clostridium difficile 630" CDS 802..1728 /codon_start=1 /gene="CD0188" /product="putative ketopantoate reductase" /label="CD0188" /protein_id="AFA34961.1" /translation="MKNQLNENNKKVVFFGVGAVGATFAEQFFNSKYDFKILCDNERKK RYLEEGFIINGKRYDFDYVTKDEYKQEADFIIIGLKYNNLKENIKELDGLVGKNTVIMS LLNGVDSEEIIGERFGIEKMVYSYVTNIDAKKINNNIIHTTNGIIVFGNKDNSEDRKTN IITEVFDDVNIEYTLSKDIQRDMWWKYMVNIGVNQTSAILGAPYGVFQSSEHLRELAKS AMREVVAIAQAKDISLTEDDVEHSLHRILEHSKEGRTSMLQDVEAHRLTEVDMFSKNIC KLGKKYNIPTPINQTFFYMIKVIESRF" gene 802..1728 /gene="CD0188" /label="CD0188" CDS 2517..2834 /codon_start=1 /gene="repH" /product="plasmid replication protein" /label="repH" /protein_id="AFA34962.1" /translation="MKRRAYMKTCKNCKEFIKDTEICKIHSLMIHDKTVATYCSKYNES RCLHKGKVQCINCSKMNRYGWCAIKMRCFTEEEQKKERTCIKYYARSFKKAHVKKSKKK K" gene 2517..2834 /gene="repH" /label="repH" CDS 3506..4126 /gene="catP" /label="Chloramphenicol acetyltransferase" /note="Chloramphenicol acetyltransferase from Clostridium perfringens. Accession#: P26826" rep_origin 4306..4894 /direction=RIGHT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" oriT 5215..5324 /label="oriT" /note="incP origin of transfer" CDS 5357..5725 /label="traJ" /note="oriT-recognizing protein"
This page is informational only.