Basic Vector Information
- Vector Name:
- pMTL-JH16
- Length:
- 5192 bp
- Type:
- Integration vector
- Replication origin:
- ori
- Source/Author:
- Heap JT, Ehsaan M, Cooksley CM, Ng YK, Cartman ST, Winzer K, Minton NP.
pMTL-JH16 vector Vector Map
pMTL-JH16 vector Sequence
LOCUS V004441 5192 bp DNA circular SYN 18-DEC-2018 DEFINITION Exported. ACCESSION V004441 VERSION V004441 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 5192) AUTHORS Heap JT, Ehsaan M, Cooksley CM, Ng YK, Cartman ST, Winzer K, Minton NP. TITLE Integration of DNA into bacterial chromosomes from plasmids without a counter-selection marker JOURNAL Nucleic Acids Res. 40 (8), E59 (2012) PUBMED 22259038 REFERENCE 2 (bases 1 to 5192) AUTHORS Heap JT, Ehsaan M, Cooksley CM, Cartman ST, Minton NP. TITLE Direct Submission JOURNAL Submitted (11-JAN-2011) School of Molecular Medical Sciences, The University of Nottingham, Centre for Biomolecular Sciences, University Park, Nottingham, Nottinghamshire NG7 2RD, United Kingdom REFERENCE 3 (bases 1 to 5192) TITLE Direct Submission REFERENCE 4 (bases 1 to 5192) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nucleic Acids Res."; date: "2012"; volume: "40"; issue: "8"; pages: "E59" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (11-JAN-2011) School of Molecular Medical Sciences, The University of Nottingham, Centre for Biomolecular Sciences, University Park, Nottingham, Nottinghamshire NG7 2RD, United Kingdom" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..5192 /mol_type="other DNA" /organism="synthetic DNA construct" regulatory 9..62 /label="derived from CD0164 gene of Clostridium difficile" /note="derived from CD0164 gene of Clostridium difficile" /regulatory_class="terminator" primer_bind 63..79 /label="M13 rev" /note="common sequencing primer, one of multiple similar variants" misc_feature 90..389 /gene="thl fragment" /note="mediates homologous recombination with the chromosome of Clostridium acetobutylicum ATCC824" gene 90..389 /gene="thl fragment" /label="thl fragment" CDS 413..1147 /gene="ermBP" /label="rRNA adenine N-6-methyltransferase" /note="rRNA adenine N-6-methyltransferase from Enterococcus faecalis. Accession#: P0A4D5" primer_bind complement(1270..1286) /label="M13 fwd" /note="common sequencing primer, one of multiple similar variants" misc_feature 1434..2633 /note="mediates homologous recombination with the chromosome of Clostridium acetobutylicum ATCC824" CDS 1869..2234 /codon_start=1 /gene="CAC2872" /product="putative FoF1-type ATP synthase operon membrane protein" /label="CAC2872" /protein_id="AFA34953.1" /translation="MNLNIKRMLKVVTLYDAIIAAIVSVILLFAANYKISLIVIIGIFS AIFNFYLSNLTADFVFVKKMGNTSLIFLSSIFRVILVFFIGIILYKIYKYYLIAYLGGY SAHFIALIIYGSLVNKR" gene 1869..2234 /gene="CAC2872" /label="CAC2872" CDS 3012..3452 /codon_start=1 /gene="repL" /product="plasmid replication protein" /label="repL" /protein_id="AFA34954.1" /translation="MKERYGTVYKGSQRLIDEESGEVIEVDKLYRKQTSGNFVKAYIVQ LISMLDMIGGKKLKIVNYILDNVHLSNNTMIATTREIAKATGTSLQTVITTLKILEEGN IIKRKTGVLMLNPELLMRGDDQKQKYLLLEFGNFEQEANEID" gene 3012..3452 /gene="repL" /label="repL" CDS 3602..4222 /gene="catP" /label="Chloramphenicol acetyltransferase" /note="Chloramphenicol acetyltransferase from Clostridium perfringens. Accession#: P26826" rep_origin 4402..4990 /direction=RIGHT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.