Basic Vector Information
- Vector Name:
- pMSP3535H3
- Length:
- 9463 bp
- Type:
- Shuttle vector
- Replication origin:
- ori
- Source/Author:
- Oddone GM, Mills DA, Block DE.
pMSP3535H3 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pMSP3535H3 vector Sequence
LOCUS V004455 9463 bp DNA circular SYN 18-DEC-2018 DEFINITION Exported. ACCESSION V004455 VERSION V004455 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 9463) AUTHORS Oddone GM, Mills DA, Block DE. TITLE Incorporation of nisI-mediated nisin immunity improves vector-based nisin-controlled gene expression in lactic acid bacteria JOURNAL Plasmid 61 (3), 151-158 (2009) PUBMED 19141301 REFERENCE 2 (bases 1 to 9463) AUTHORS Oddone GM, Kim J-H. TITLE Direct Submission JOURNAL Submitted (16-DEC-2008) Viticulture and Enology, University of California, Davis, RMI North Lab, 595 Hilgard Lane, Davis, CA 95616, USA REFERENCE 3 (bases 1 to 9463) TITLE Direct Submission REFERENCE 4 (bases 1 to 9463) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Plasmid"; date: "2009"; volume: "61"; issue: "3"; pages: "151-158" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (16-DEC-2008) Viticulture and Enology, University of California, Davis, RMI North Lab, 595 Hilgard Lane, Davis, CA 95616, USA" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..9463 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 332..1066 /gene="ermBP" /label="rRNA adenine N-6-methyltransferase" /note="rRNA adenine N-6-methyltransferase from Enterococcus faecalis. Accession#: P0A4D5" CDS 1971..2270 /codon_start=1 /gene="repD" /product="RepD" /label="repD" /note="replication factor" /protein_id="ACM62692.1" /translation="MNHDECKTYIKNSLLEIRKLANIYTLETFKKELEKRNIYLETKSD KYFSSEGEDYIYKLIENNKIIYSISGKKLTYKGKKSFSKHAILKQLNEKANQVN" gene 1971..2270 /gene="repD" /label="repD" CDS 2313..3803 /codon_start=1 /gene="repE" /product="RepE" /label="repE" /note="replication factor" /protein_id="ACM62693.1" /translation="MNIPFVVETVLHDGLLKYKFKNSKIRSITTKPGKSKGAIFAYRSK SSMIGGRGVVLTSEEAIQENQDTFTHWTPNVYRYGTYADENRSYTKGHSENNLRQINTF FIDFDIHTAKETISASDILTTAIDLGFMPTMIIKSDKGYQAYFVLETPVYVTSKSEFKS VKAAKIISQNIREYFGKSLPVDLTCNHFGIARIPRTDNVEFFDPNYRYSFKEWQDWSFK QTDNKGFTRSSLTVLSGTEGKKQVDEPWFNLLLHETKFSGEKGLIGRNNVMFTLSLAYF SSGYSIETCEYNMFEFNNRLDQPLEEKEVIKIVRSAYSENYQGANREYITILCKAWVSS DLTSKDLFVRQGWFKFKKKRSERQRVHLSEWKEDLMAYISEKSDVYKPYLVTTKKEIRE VLGIPERTLDKLLKVLKANQEIFFKIKPGRNGGIQLASVKSLLLSIIKVKKEEKESYIK ALTNSFDLEHTFIQETLNKLAERPKTDTQLDLFSYDTG" gene 2313..3803 /gene="repE" /label="repE" CDS 4153..4290 /codon_start=1 /gene="repG" /product="RepG" /label="repG" /note="replication factor" /protein_id="ACM62694.1" /translation="MEKYLKNPITWIGLVLVVTWFLTKSSEFLIFGVCVLLLVFASQSD " gene 4153..4290 /gene="repG" /label="repG" CDS 4440..5177 /codon_start=1 /gene="nisI" /product="NisI" /label="nisI" /note="nisin immunity protein; provides significant protection from the toxic effects of the inducer nisin" /protein_id="ACM62695.1" /translation="MRKYLILIVALIGITGLSGCYQTSQKKVRFDEGSYTNFIYDNKSY FVTDKEIPQENVNNCKVKFYNLLIVDMKSEKLLSSSNKNSVTLVLNNIYEASDKSLCMG INDRYYKILPESDKGVVKALRLQNFDVTSDISDDNFVIDKNDSRKIDYMGNIYSISDTT VSDEELGEYQDVLAEVRVFDSVSGKSIPRSEWGRIDKDGSNSKQSRTEWDYGEIHSIRG KSLTEAFAVEINDDFKLATKVGN" gene 4440..5177 /gene="nisI" /label="nisI" CDS 5406..6044 /codon_start=1 /gene="nisR" /product="NisR" /label="nisR" /note="nis operon regulator protein" /protein_id="ACM62696.1" /translation="MKTALEMRNYEVATHQNISLPLDITDFQGFDLILLDIMMSNIEGT EICKRIRREISTPIIFVSAKDTEEDIINGLGIGGDDYITKPFSLKQLVAKVEANIKREE RNKHAVHVFSEIRRDLGPITFYLEERRVCVNGQTIPLTCREYDILELLSQRTSKVYTRE DIYDDVYDEYSNALFRSISEYIYQIRSKFAPYDINPIKTVRGLGYQWHG" gene 5406..6044 /gene="nisR" /label="nisR" CDS 6037..7377 /gene="nisK" /label="Nisin biosynthesis sensor protein NisK" /note="Nisin biosynthesis sensor protein NisK from Lactococcus lactis subsp. lactis. Accession#: P42707" rep_origin 7882..8470 /direction=RIGHT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" promoter 8728..8746 /label="T7 promoter" /note="promoter for bacteriophage T7 RNA polymerase" primer_bind 9147..9163 /label="M13 fwd" /note="common sequencing primer, one of multiple similar variants" misc_feature 9164..9220 /label="MCS" /note="pUC18/19 multiple cloning site" primer_bind complement(9233..9249) /label="M13 rev" /note="common sequencing primer, one of multiple similar variants"
This page is informational only.