Basic Vector Information
- Vector Name:
- pMSP3535
- Length:
- 8353 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Bryan EM, Bae T, Kleerebezem M, Dunny GM.
pMSP3535 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pMSP3535 vector Sequence
LOCUS V004456 8353 bp DNA circular SYN 18-DEC-2018 DEFINITION Exported. ACCESSION V004456 VERSION V004456 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 8353) AUTHORS Bryan EM, Bae T, Kleerebezem M, Dunny GM. TITLE Improved vectors for nisin-controlled expression in gram-positive bacteria JOURNAL Plasmid 44 (2), 183-190 (2000) PUBMED 10964628 REFERENCE 2 (bases 1 to 8353) AUTHORS Staddon JH, Bryan EM, Manias DA, Dunny GM. TITLE Conserved target for group II intron insertion in relaxase genes of conjugative elements of gram-positive bacteria JOURNAL J. Bacteriol. 186 (8), 2393-2401 (2004) PUBMED 15060042 REFERENCE 3 (bases 1 to 8353) AUTHORS Staddon JH, Bryan EM, Manias DA, Bae T, Kleerebezem M, Dunny GM. TITLE Direct Submission JOURNAL Submitted (21-MAY-2003) Microbiology, University of Minnesota, MMC 196, 420 Delaware Street S.E., Minneapolis, MN 55455, USA REFERENCE 4 (bases 1 to 8353) TITLE Direct Submission REFERENCE 5 (bases 1 to 8353) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Plasmid"; date: "2000"; volume: "44"; issue: "2"; pages: "183-190" SGRef: number: 2; type: "Journal Article"; journalName: "J. Bacteriol."; date: "2004"; volume: "186"; issue: "8"; pages: "2393-2401" SGRef: number: 3; type: "Journal Article"; journalName: "Submitted (21-MAY-2003) Microbiology, University of Minnesota, MMC 196, 420 Delaware Street S.E., Minneapolis, MN 55455, USA" SGRef: number: 4; type: "Journal Article" FEATURES Location/Qualifiers source 1..8353 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 332..1066 /gene="ermBP" /label="rRNA adenine N-6-methyltransferase" /note="rRNA adenine N-6-methyltransferase from Enterococcus faecalis. Accession#: P0A4D5" CDS 2046..2345 /codon_start=1 /product="RepD" /label="RepD" /protein_id="AAP60030.1" /translation="MNHDECKTYIKNSLLEIRKLANIYTLETFKKELEKRNIYLETKSD KYFSSEGEDYIYKLIENNKIIYSISGKKLTYKGKKSFSKHAILKQLNEKANQVN" CDS 2388..3878 /codon_start=1 /product="RepE" /label="RepE" /note="plasmid replication; pAMbeta1 plasmid replicon" /protein_id="AAP60031.1" /translation="MNIPFVVETVLHDGLLKYKFKNSKIRSITTKPGKSKGAIFAYRSK SSMIGGRGVVLTSEEAIQENQDTFTHWTPNVYRYGTYADENRSYTKGHSENNLRQINTF FIDFDIHTAKETISASDILTTAIDLGFMPTMIIKSDKGYQAYFVLETPVYVTSKSEFKS VKAAKIISQNIREYFGKSLPVDLTCNHFGIARIPRTDNVEFFDPNYRYSFKEWQDWSFK QTDNKGFTRSSLTVLSGTEGKKQVDEPWFNLLLHETKFSGEKGLIGRNNVMFTLSLAYF SSGYSIETCEYNMFEFNNRLDQPLEEKEVIKIVRSAYSENYQGANREYITILCKAWVSS DLTSKDLFVRQGWFKFKKKRSERQRVHLSEWKEDLMAYISEKSDVYKPYLVTTKKEIRE VLGIPERTLDKLLKVLKANQEIFFKIKPGRNGGIQLASVKSLLLSIIKVKKEEKESYIK ALTNSFDLEHTFIQETLNKLAERPKTDTQLDLFSYDTG" CDS 4228..4365 /codon_start=1 /product="RepG" /label="RepG" /protein_id="AAP60032.1" /translation="MEKYLKNPITWIGLVLVVTWFLTKSSEFLIFGVCVLLLVFASQSD " CDS 4614..5252 /codon_start=1 /product="NisR" /label="NisR" /note="response regulator" /protein_id="AAP60033.1" /translation="MKTALEMRNYEVATHQNISLPLDITDFQGFDLILLDIMMSNIEGT EICKRIRREISTPIIFVSAKDTEEDIINGLGIGGDDYITKPFSLKQLVAKVEANIKREE RNKHAVHVFSEIRRDLGPITFYLEERRVCVNGQTIPLTCREYDILELLSQRTSKVYTRE DIYDDVYDEYSNALFRSISEYIYQIRSKFAPYDINPIKTVRGLGYQWHG" CDS 5245..6585 /gene="nisK" /label="Nisin biosynthesis sensor protein NisK" /note="Nisin biosynthesis sensor protein NisK from Lactococcus lactis subsp. lactis. Accession#: P42707" rep_origin 7090..7678 /direction=RIGHT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" promoter 7936..7954 /label="T7 promoter" /note="promoter for bacteriophage T7 RNA polymerase" regulatory 8045..8353 /note="PnisA; nisin inducible promoter" /regulatory_class="promoter"
This page is informational only.