Basic Vector Information
- Vector Name:
- pMSD2
- Length:
- 5833 bp
- Type:
- Cloning vector
- Replication origin:
- pBBR1 oriV
- Source/Author:
- Meng J, Wang H, Liu X, Lin J, Pang X, Lin J.
- Promoter:
- tac
pMSD2 vector Map
pMSD2 vector Sequence
LOCUS 40924_32390 5833 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pMSD2, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5833) AUTHORS Meng J, Wang H, Liu X, Lin J, Pang X, Lin J. TITLE Construction of small plasmid vectors for use in genetic improvement of the extremely acidophilic Acidithiobacillus caldus JOURNAL Microbiol. Res. 168 (8), 469-476 (2013) PUBMED 23639949 REFERENCE 2 (bases 1 to 5833) AUTHORS Meng J, Wang H, Liu X. TITLE Direct Submission JOURNAL Submitted (27-FEB-2013) State Key Laboratory of Microbial Technology, Shandong University, Shanda Nanlu 27#, Jinan, Shandong 250100, China REFERENCE 3 (bases 1 to 5833) TITLE Direct Submission REFERENCE 4 (bases 1 to 5833) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Microbiol. Res."; date: "2013"; volume: "168"; issue: "8"; pages: "469-476" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (27-FEB-2013) State Key Laboratory of Microbial Technology, Shandong University, Shanda Nanlu 27#, Jinan, Shandong 250100, China" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..5833 /mol_type="other DNA" /organism="synthetic DNA construct" rep_origin 1023..1792 /label=pBBR1 oriV /note="replication origin of the broad-host-range plasmid pBBR1 from Bordetella bronchiseptica; requires the pBBR1 Rep protein for replication" CDS 1793..2452 /codon_start=1 /label=pBBR1 Rep /note="replication protein for the broad-host-range plasmid pBBR1 from Bordetella bronchiseptica" /translation="MATQSREIGIQAKNKPGHWVQTERKAHEAWAGLIARKPTAAMLLH HLVAQMGHQNAVVVSQKTLSKLIGRSLRTVQYAVKDLVAERWISVVKLNGPGTVSAYVV NDRVAWGQPRDQLRLSVFSAAVVVDHDDQDESLLGHGDLRRIPTLYPGEQQLPTGPGEE PPSQPGIPGMEPDLPALTETEEWERRGQQRLPMPDEPCFLDDGEPLEPPTRVTLPRR" primer_bind 3162..3178 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" promoter 3188..3206 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" misc_feature 3215..3322 /label=MCS /note="pBluescript multiple cloning site" protein_bind complement(3339..3355) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(3363..3391) /label=tac promoter /note="strong E. coli promoter; hybrid between the trp and lac UV5 promoters" CDS 3656..4459 /codon_start=1 /gene="strA" /product="Sm resistance protein A" /label=strA /protein_id="AGT62536.1" /translation="MNRTNIFFGESHSDWLPVRGGESGDFVFRRGDGHAFAKIAPASRR GELAGERDRLIWLKGRGVACPEVINWQEEQEGACLVITAIPGVPAADLSGADLLKAWPS MGQQLGAVHSLSVDQCPFERRLSRMFGRAVDVVSRNAVNPDFLPDEDKSTPLHDLLARV ERELPVRLDQERTDMVVCHGDPCMPNFMVDPKTLQCTGLIDLGRLGTADRYADLALMIA NAEENWAAPDEAERAFAVLFNVLGIEAPDRERLAFYLRLDPLTWG" gene 3656..4459 /gene="strA" /label=strA CDS 4459..5295 /codon_start=1 /gene="strB" /product="Sm resistance protein B" /label=strB /protein_id="AGT62537.1" /translation="MFMPPVFPAHWHVSQPVLIADTFSSLVWKVSLPDGTPAIVKGLKP IEDIADELRGADYLVWRNGRGAVRLLGRENNLMLLEYAGERMLSHIVAEHGDYQATEIA AELMAKLYAASEEPLPSALLPIRDRFAALFQRARDDQNAGCQTDYVHAAIIADQMMSNA SELRGLHGDLHHENIMFSSRGWLVIDPVGLVGEVGFGAANMFYDPADRDDLCLDPRRIA QMADAFSRALDVDPRRLLDQAYAYGCLSAAWNADGEEEQRDLAIAAAIKQVRQTSY" gene 4459..5295 /gene="strB" /label=strB
This page is informational only.